DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Zfp341

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_955008.2 Gene:Zfp341 / 228807 MGIID:2682937 Length:846 Species:Mus musculus


Alignment Length:353 Identity:91/353 - (25%)
Similarity:139/353 - (39%) Gaps:89/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 SASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVV----------------FN 384
            |.||..|.| :.|...:|                .|:|||..:.|::                |.
Mouse   409 SLSSTTQPQ-ALPTAGED----------------EGDKPEAKQVVLIDSSYLCQFCPSKFSTYFQ 456

  Fly   385 LGEEISQ--EQQVF---------------SFHENVIIVEKEQNDR-------------------- 412
            |...:.|  ::||:               :|.|::...::|.:.|                    
Mouse   457 LKSHMIQHKKEQVYKCVVKSCAQMFPKLDTFLEHIRSHQEELSYRCHLCSKDFPSLYDLGVHQYS 521

  Fly   413 DEQTPLKRKRSSELVFK-----QESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHI 472
            ....|....:....|:|     .:.|.|:.....:.....||.|..|...||.::.|.||..|| 
Mouse   522 HSLLPQHSPKKDSTVYKCVKCVNKYSTPEALEHHVQTATHSFPCPHCQKVFPCERYLRRHLPTH- 585

  Fly   473 KGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVK 537
                 |.||..:|..|.........||.|..||:|.||:|||.||.:|::::.|||||..|...|
Mouse   586 -----GSGGRFRCQICKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFK 645

  Fly   538 RHQCP-----QCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAG-VMF 596
            :::||     .||..|.::..|:.|| ..|.| .:.|||.||.:||:..:.|:.|...|.| ..|
Mouse   646 KYKCPFSMHTGCSKEFNRQDKLKAHI-LSHAG-LKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKF 708

  Fly   597 SCKQCGRQFNDRSAVQRHVTTMHKVKNK 624
            .|..|.:.|:....::.|...:...|:|
Mouse   709 RCAGCAKGFSRHKYLKDHRCRLGPTKDK 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 30/75 (40%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 14/24 (58%)
C2H2 Zn finger 513..533 CDD:275368 10/19 (53%)
zf-H2C2_2 526..550 CDD:290200 12/28 (43%)
C2H2 Zn finger 541..562 CDD:275368 8/25 (32%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368 4/18 (22%)
Zfp341NP_955008.2 COG5048 321..726 CDD:227381 88/341 (26%)
zf-C2H2 321..342 CDD:278523
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 334..359 CDD:290200
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 444..464 CDD:275368 2/19 (11%)
C2H2 Zn finger 472..494 CDD:275368 2/21 (10%)
C2H2 Zn finger 502..522 CDD:275368 0/19 (0%)
C2H2 Zn finger 539..561 CDD:275370 2/21 (10%)
C2H2 Zn finger 565..585 CDD:275368 7/19 (37%)
C2H2 Zn finger 593..613 CDD:275368 5/19 (26%)
zf-H2C2_2 605..630 CDD:290200 14/24 (58%)
C2H2 Zn finger 621..641 CDD:275368 10/19 (53%)
C2H2 Zn finger 649..674 CDD:275368 8/25 (32%)
C2H2 Zn finger 682..702 CDD:275368 7/19 (37%)
C2H2 Zn finger 710..727 CDD:275368 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4907
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.