Sequence 1: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016881094.1 | Gene: | ZBTB7C / 201501 | HGNCID: | 31700 | Length: | 668 | Species: | Homo sapiens |
Alignment Length: | 377 | Identity: | 82/377 - (21%) |
---|---|---|---|
Similarity: | 136/377 - (36%) | Gaps: | 125/377 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 DNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQ 391
Fly 392 EQQVFSFHENVI----IVEKEQNDRDEQTP------------LKRKRSSELVFKQ----ESSCPQ 436
Fly 437 PKTGRITDTVKSFQCHLCPVAF------PTQ-------KLLTRHHN------------------- 469
Fly 470 ---------------------------------THIKGL----------KSGKGGTLKCPSCALQ 491
Fly 492 LSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQ 556
Fly 557 HIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGVMFSCKQC----GRQ 604 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | |
vATP-synt_E | 109..>244 | CDD:304907 | |||
RRF | <161..222 | CDD:294170 | |||
zf-C2H2_8 | 454..530 | CDD:292531 | 29/150 (19%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | 3/11 (27%) | ||
ZBTB7C | XP_016881094.1 | BTB | 73..176 | CDD:279045 | |
BTB | 84..177 | CDD:197585 | |||
C2H2 Zn finger | 415..435 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 430..452 | CDD:290200 | 12/21 (57%) | ||
C2H2 Zn finger | 443..463 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 456..480 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 471..491 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 483..508 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 499..517 | CDD:275368 | 7/17 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |