DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and Zbtb7a

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006513342.3 Gene:Zbtb7a / 16969 MGIID:1335091 Length:725 Species:Mus musculus


Alignment Length:420 Identity:98/420 - (23%)
Similarity:133/420 - (31%) Gaps:149/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DDLRNEVSEDIRKEQLAMLLGE---LEVYLTEKKAGRWESLDGSE----PETKPQVKEDASPSRS 249
            ||..:...|.:.....|:..|:   |:.|.....|.|..:.||.|    |...|:..|||.|.  
Mouse   342 DDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPAGDGDEGDSTPGLWPERDEDAPPG-- 404

  Fly   250 KTKAL--PKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVP------ 306
               .|  |...|.....|.....|.....|||                  ...|.|..|      
Mouse   405 ---GLFPPPTAPPATTQNGHYGRAGAGTGEEE------------------AAALSEAAPEPGDSP 448

  Fly   307 -----AESGEDFREINMVGSDVVHTDN--GEIYIINSASSEDQNQDSTPEF-DQDNGITSYNIKE 363
                 |..|||        .|....|.  ....:....||..:..||..|. ..|.|:..|.:| 
Mouse   449 GFLSGAAEGED--------GDAADVDGLAASTLLQQMMSSVGRAGDSDEESRTDDKGVMDYYLK- 504

  Fly   364 DGEIQFSGEKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVF 428
                .|||.                          ||..:.....|...      |:.|:     
Mouse   505 ----YFSGA--------------------------HEGDVYPAWSQKGE------KKIRA----- 528

  Fly   429 KQESSCPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLS 493
                              |:||                                 |||.|...:.
Mouse   529 ------------------KAFQ---------------------------------KCPICEKVIQ 542

  Fly   494 CASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHI 558
            .|..|.||:..|||.||::|:.|::.|::::.||.||..|||.|.:.|.||.:.||...:|:.|:
Mouse   543 GAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHM 607

  Fly   559 GRVHMGNSRTHKCHLCHRSFNHVSGLSRHL 588
             |||.| .|.::|..|.::|.....|.|||
Mouse   608 -RVHTG-LRPYQCDSCCKTFVRSDHLHRHL 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 15/58 (26%)
RRF <161..222 CDD:294170 7/32 (22%)
zf-C2H2_8 454..530 CDD:292531 18/75 (24%)
C2H2 Zn finger 485..505 CDD:275368 7/19 (37%)
zf-H2C2_2 497..522 CDD:290200 11/24 (46%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 12/23 (52%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 7/18 (39%)
C2H2 Zn finger 598..617 CDD:275368
Zbtb7aXP_006513342.3 BTB_POZ_ZBTB7A 165..284 CDD:349635
C2H2 Zn finger 534..554 CDD:275368 7/19 (37%)
zf-H2C2_2 549..571 CDD:404364 10/21 (48%)
C2H2 Zn finger 562..582 CDD:275368 7/19 (37%)
zf-H2C2_2 575..599 CDD:404364 12/23 (52%)
C2H2 Zn finger 590..610 CDD:275368 8/20 (40%)
zf-H2C2_2 602..627 CDD:404364 10/26 (38%)
C2H2 Zn finger 618..636 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.