DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31365 and zbtb49

DIOPT Version :9

Sequence 1:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001076468.1 Gene:zbtb49 / 100009630 ZFINID:ZDB-GENE-070209-170 Length:524 Species:Danio rerio


Alignment Length:390 Identity:100/390 - (25%)
Similarity:147/390 - (37%) Gaps:100/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 PANNSDV------NIDG------------LELDEE---VPAESGEDFREINMVG------SDVVH 325
            ||..|||      ::.|            |||::|   ...|.|:..:.:|::.      ...|.
Zfish    58 PAQKSDVFHLSIQDVSGIGQLLDYMYTSHLELNQENVHTLLEIGQSLQVLNVLNMCHAFLKPCVS 122

  Fly   326 TDN--------GEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVV 382
            .|:        |...:....:||.|....|.:..     :.|:.:...:...:|..|.       
Zfish   123 ADSASSCCVSAGPECVSGPGASEPQEPPHTHKLR-----SFYSRQYLQQSPAAGPAPS------- 175

  Fly   383 FNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCP------QPKTGR 441
               |....|       |:..:.|:|          ....||.|   ::|..|.      .|.|..
Zfish   176 ---GPGAPQ-------HKKTLYVKK----------FNYLRSQE---EEEERCAGGHAPCGPATPS 217

  Fly   442 ITDTVKSFQC---------HLCPVAFPTQKL-LTR-----HHNT------HIKGLKSGKGGTLKC 485
            ..||..|..|         .||..:.|.:.. |.|     ..||      ...|:..|.|....|
Zfish   218 SADTTPSDLCVTSDLCVTPDLCVTSDPAEAAELERTPEAEPGNTGPQGQEQRSGVSGGGGNKYCC 282

  Fly   486 PSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQ 550
            ..|.......|:|:.|...|||.|||:||.|..:|||...|:.|:..|:|.|.:.|..|...||.
Zfish   283 EVCGKTFKHPSNLELHKRSHTGEKPFQCSVCGKAFSQAGNLQTHLRRHSGEKPYICELCGKSFAA 347

  Fly   551 KSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH-AGVMFSCKQCGRQFNDRSAVQRH 614
            ..::|:|| .:|.| :|.|.|.:|.|.|::.|.|..|..|| |...|:|.|||:.||.:..:.:|
Zfish   348 SGDVQRHI-IIHSG-ARPHLCDVCGRGFSNFSNLKEHKKTHRAEREFTCDQCGKSFNMQRKLLKH 410

  Fly   615  614
            Zfish   411  410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907
RRF <161..222 CDD:294170
zf-C2H2_8 454..530 CDD:292531 27/87 (31%)
C2H2 Zn finger 485..505 CDD:275368 5/19 (26%)
zf-H2C2_2 497..522 CDD:290200 12/24 (50%)
C2H2 Zn finger 513..533 CDD:275368 8/19 (42%)
zf-H2C2_2 526..550 CDD:290200 8/23 (35%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..617 CDD:275368 7/17 (41%)
zbtb49NP_001076468.1 zf-H2C2_2 322..346 CDD:290200 7/23 (30%)
C2H2 Zn finger 338..358 CDD:275368 7/20 (35%)
C2H2 Zn finger 366..386 CDD:275368 7/19 (37%)
zf-H2C2_2 378..402 CDD:290200 10/23 (43%)
C2H2 Zn finger 394..414 CDD:275368 7/17 (41%)
zf-H2C2_2 407..430 CDD:290200 1/4 (25%)
C2H2 Zn finger 422..442 CDD:275368
zf-H2C2_2 434..459 CDD:290200
C2H2 Zn finger 450..467 CDD:275368
BTB 15..118 CDD:279045 13/59 (22%)
BTB 26..118 CDD:197585 13/59 (22%)
zf-C2H2 280..302 CDD:278523 5/21 (24%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
COG5048 <292..466 CDD:227381 49/121 (40%)
zf-H2C2_2 294..319 CDD:290200 12/24 (50%)
C2H2 Zn finger 310..330 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.