DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and ARFGAP2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_005253223.1 Gene:ARFGAP2 / 84364 HGNCID:13504 Length:560 Species:Homo sapiens


Alignment Length:423 Identity:96/423 - (22%)
Similarity:149/423 - (35%) Gaps:132/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PAKRRIH--WEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD 439
            |.|..|.  ::....:|.|..|.||.:..|.||||..|:.|||:|||||||||||.|.:||..||
Human     5 PNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELD 69

  Fly   440 A-WESENVKVMMELGNEVVNRIYE---------------------------------ARIGDDCG 470
            : |....::.|...||......:.                                 ||.|.|..
Human    70 SNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQLGSAALARHGTDLW 134

  Fly   471 L-------------KKPTE------QCEIGV----REAWI-KAKYVERRFVCGMPKPQELLASET 511
            :             ||.::      |..:|:    ::.|: :|..:...|   .|...:..|:|.
Human   135 IDNMSSAVPNHSPEKKDSDFFTEHTQVLVGLGASCQQEWLTEASVIWPPF---QPPAWDAPATEP 196

  Fly   512 A----EVLSIDSGGVVEDGESGGS----GIAKRATLS-------------------LGGTRKWAV 549
            :    ...|.:|.|:.:. |.|.:    |.:.:|:|.                   :|..:..|.
Human   197 SGTQQPAPSTESSGLAQP-EHGPNTDLLGTSPKASLESVYLSAKGALPARELKSSIIGKKKPAAA 260

  Fly   550 KKLRRRQKQRSIPKTLSDDPS-IYNTAKTGDELEDD-------DDDESINIPSMSLSISRDDLLV 606
            ||....:|.....|..|...| |...|:..::|.:.       ..:||: :.||.|:.       
Human   261 KKGLGAKKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEESM-VASMRLAY------- 317

  Fly   607 IGDDLALDRLETPGILGSDQESTDGESDAESPEELPF-----SQLDANQLLYMASVVHNLPVMCM 666
              .:|.:||.:....|    ::.:|:. .|..|.|..     |.:..:.|..|..:....||...
Human   318 --QELQIDRKKEEKKL----QNLEGKK-REQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAK 375

  Fly   667 A-------------FALGADKMWKNPQDRQRSF 686
            :             ||.|..|...||.....||
Human   376 SSRSQLDLFDDVGTFASGPPKYKDNPFSLGESF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 44/170 (26%)
ANK 652..768 CDD:238125 11/48 (23%)
Ank_4 683..736 CDD:290365 2/4 (50%)
ANK repeat 687..713 CDD:293786 96/423 (23%)
ANK repeat 715..746 CDD:293786
ARFGAP2XP_005253223.1 PLN03114 1..510 CDD:178661 96/423 (23%)
ArfGap 11..117 CDD:279720 34/105 (32%)
RILP-like 266..>338 CDD:304877 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.