DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Git1

DIOPT Version :10

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_114002.1 Gene:Git1 / 83709 RGDID:69331 Length:770 Species:Rattus norvegicus


Alignment Length:118 Identity:42/118 - (35%)
Similarity:63/118 - (53%) Gaps:5/118 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 KIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELG 453
            |.|....|.||.:|:|.||||:.|:.:|.||..||||||.|.|.|:.|...||....::::..|.
  Rat     4 KGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLA 68

  Fly   454 NEVVNRIYEARIGD----DCGLKKPTEQCEI-GVREAWIKAKYVERRFVCGMP 501
            :...|.|:|..:.|    ..|.:|...|.:: .::..:|:|||....||..:|
  Rat    69 SNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLP 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH_ACAP 260..355 CDD:270070
ArfGap_ACAP 381..497 CDD:350064 39/112 (35%)
ANKYR <647..>768 CDD:440430
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Git1NP_114002.1 Interaction with gamma-tubulin and localization to the centrosome. /evidence=ECO:0000250|UniProtKB:Q9Y2X7 1..124 42/118 (36%)
ArfGap_GIT1 1..111 CDD:350071 37/106 (35%)
ANKYR <123..221 CDD:440430
ANK 1 132..161
ANK repeat 137..165 CDD:293786
ANK 2 166..195
ANK repeat 167..197 CDD:293786
ANK 3 199..228
Interaction with PCLO. /evidence=ECO:0000269|PubMed:12473661 245..374
Interaction with PTK2/FAK1. /evidence=ECO:0000269|PubMed:10938112 253..424
Interaction with ARHGEF7. /evidence=ECO:0000269|PubMed:10938112 254..376
GIT_SHD <281..301 CDD:462506
GIT_SHD 337..365 CDD:462506
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..425
Interaction with NCK2 and GRIN3A. /evidence=ECO:0000269|PubMed:17310244, ECO:0000269|PubMed:24297929 375..596
Required for localization at synapses. /evidence=ECO:0000250|UniProtKB:Q9Y2X7 375..596
GIT_CC 418..483 CDD:465174
Interaction with MAPK1. /evidence=ECO:0000250|UniProtKB:Q68FF6 420..475
Interaction with IKBKG. /evidence=ECO:0000250|UniProtKB:Q9Y2X7 429..629
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..615
Interaction with PXN and TGFB1I1. /evidence=ECO:0000269|PubMed:10938112, ECO:0000269|PubMed:12153727 646..770
GIT1_C 652..765 CDD:463492
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.