DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Arfgap2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001159496.1 Gene:Arfgap2 / 77038 MGIID:1924288 Length:534 Species:Mus musculus


Alignment Length:438 Identity:94/438 - (21%)
Similarity:144/438 - (32%) Gaps:138/438 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PAKRRIH--WEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD 439
            |:|..|.  ::....||.|..|.||.:..|.||||..|:.|||:|||||||||||.|.:||..||
Mouse     5 PSKTEIQTIFKRLRAIPTNKACFDCGAKSPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELD 69

  Fly   440 A-WESENVKVMMELGNEVVNRIYEAR--IGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMP 501
            : |....::.|...||......:...  :.:|.                  ..||..|.......
Mouse    70 SNWSWLQLRCMQVGGNANATAFFRQHGCMANDA------------------NTKYTSRAAQMYRE 116

  Fly   502 KPQELLASETAEVLSIDSGGVVEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIP---- 562
            |.::|                       ||     |.|:..||..|.       ....|.|    
Mouse   117 KIRQL-----------------------GS-----AALTRHGTDLWI-------DSMNSAPSHSP 146

  Fly   563 -KTLSD------DPSIYNTAKTGDELEDDDDDESINIPSMSLSISR------DDLLVIGDDLALD 614
             |..||      ....::||.|     |....:...:||.|.|:::      .|||......:|:
Mouse   147 EKKDSDFFTEHTQAPAWDTAAT-----DPSGTQQPALPSESSSLAQPEQGPNTDLLGTSPQASLE 206

  Fly   615 R--LETPG----------ILG----------------------SDQESTDGESDAESPEELPFSQ 645
            .  |...|          |:|                      |:|..|:.|..|:..|:|...|
Mouse   207 SMYLSAKGPSCTRELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSNQSFTEIERQAQVAEKLREQQ 271

  Fly   646 LDANQLLYMASVVHNLPVMCMAFALGADKMWKNPQDRQRSFLHQAVISGSVMACEFLLLNGAAID 710
            ....:.....|:|.::.:......:...|..|..|:                      |.|...:
Mouse   272 AADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQN----------------------LEGKKRE 314

  Fly   711 AVDEMGYSALHISTAKGHIAQVYLLLKHKAAYDLSSSDGKKALDIAVD 758
            ..:.:|...:..|:....:.....:::.:.  .||:...:..||:..|
Mouse   315 QAERLGMGLVSRSSISHSVLSEMQMIEQET--PLSAKSSRSQLDLFDD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 39/115 (34%)
ANK 652..768 CDD:238125 14/107 (13%)
Ank_4 683..736 CDD:290365 4/52 (8%)
ANK repeat 687..713 CDD:293786 2/25 (8%)
ANK repeat 715..746 CDD:293786 3/30 (10%)
Arfgap2NP_001159496.1 PLN03114 3..484 CDD:178661 94/438 (21%)
ArfGap 11..117 CDD:279720 39/123 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.