DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Appl1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_660256.1 Gene:Appl1 / 72993 MGIID:1920243 Length:707 Species:Mus musculus


Alignment Length:491 Identity:110/491 - (22%)
Similarity:206/491 - (41%) Gaps:84/491 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEFEECLKDSPRFRQFVSKEESDIEHLEQRLEKIIKLCNVAVDSGKEYVKNQSAFAMSL------ 63
            :..||.|:|||:.|..:...|.|...:...:.::.:..:...|:     :|:.:.|..|      
Mouse     7 LPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDA-----QNELSAATHLTSKLLK 66

  Fly    64 -WDLQQHFL--DNKNAHNALGKLIHCFQEMNKFHTILLDQASRTVLKNLSVFVKDDINQVKDYKG 125
             ::.|:..|  |::...:.|.:......|::..|.:|..|.:..::..:|.|.:.|:.::...|.
Mouse    67 EYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKERDLKEILTLKE 131

  Fly   126 HFLKVSEGYDNALIKNAQASKNRPQE--MQEAANILSASKSCFQHTALDYVNYITLAQARKVPSI 188
            .|...|..:|.|:.:.::.||.|..:  ..|....:..|:.....|.:.|...:...|.:|..::
Mouse   132 VFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIAL 196

  Fly   189 LSTLLDYYQACVTYYHQGFDLCN-DFDEFFKNISEDLNALR----GDYQQLEKAMQNRHMS---- 244
            |..||.|.||.::::..|.:..| ..:||..||...:..:|    ||.:.:::.:::..::    
Mouse   197 LEPLLGYMQAQISFFKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPL 261

  Fly   245 -----------VNRYCDSNTNSTSNKIEGYLFKKKSKGF--KTWCRRWFYLSDNQLVYRKRSNED 296
                       :||      |.|  :..|||..:...|.  .||.|::::.....|:.:.|.  |
Mouse   262 YLPDPDPTKFPINR------NLT--RKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARG--D 316

  Fly   297 SFSVMEEDLRICSVRPVNEGDRRFCFEVIS--PTKSHILQADSADMLSLWISALQHSIGAAIQHD 359
            ....:..|:..|||..|:..|||:||::.|  ..||.||||:|......||..:.:     |...
Mouse   317 VAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINN-----ISKQ 376

  Fly   360 STHHSRPQSTNAPNNS--------LPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLC 416
            ......|:.|.|..|.        .|:.::.|  |.|: ||.    ..|.|..|.:|        
Mouse   377 IYLSENPEETAARVNQSALEAVTPSPSFQQRH--ESLR-PGG----QSRPPTARTSS-------- 426

  Fly   417 IECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMEL 452
               ||   |||...:.:.:|:||:..:.:..:..::
Mouse   427 ---SG---SLGSESTNLAALSLDSLVAPDTPIQFDI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 41/210 (20%)
PH 259..352 CDD:278594 30/96 (31%)
PH_ACAP 260..355 CDD:270070 30/98 (31%)
ArfGap 384..497 CDD:279720 16/69 (23%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Appl1NP_660256.1 Required for RAB5A binding. /evidence=ECO:0000250 1..428 102/458 (22%)
BAR_APPL1 20..234 CDD:153315 44/218 (20%)
BAR-PH_APPL 252..376 CDD:270067 35/138 (25%)
PH 280..375 CDD:278594 31/101 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..433 15/56 (27%)
F&H. /evidence=ECO:0000250 403..414 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..490
PTB_APPL 489..624 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.