DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Arfgap3

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001344685.1 Gene:Arfgap3 / 66251 MGIID:1913501 Length:525 Species:Mus musculus


Alignment Length:406 Identity:94/406 - (23%)
Similarity:147/406 - (36%) Gaps:104/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PAKRRI--HWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD 439
            |:|:.|  .::....:|.|..|.||.:..|.||||:.|:.|||:|||.|||||||.|.:||..||
Mouse     4 PSKQDILAIFKRLRSVPTNKVCFDCGAKNPSWASISYGVFLCIDCSGSHRSLGVHLSFIRSTELD 68

  Fly   440 A-WESENVKVMMELGNEVVNRIYEAR--IGDDCGLKKPTEQCEIGVREAWIKAKYVERRF----- 496
            : |....::.|...||...:..:...  ...|...|..:...::...:....|....||.     
Mouse    69 SNWSWFQLRCMQVGGNSNASSFFHQHGCATKDTNAKYNSRAAQLYREKIKTLATQATRRHGTDLW 133

  Fly   497 --------VCGMPKPQELLASETAEVLSIDSGGVVE-------------------DGESGGSG-- 532
                    |...||.::..||..    |::..|.::                   :...||.|  
Mouse   134 LDSCAAPPVSPPPKEEDFFASHA----SLEVSGAMQASAQPESASSTPWGLETTPEKHEGGPGQG 194

  Fly   533 --------IAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTLSDDPSIYNT--------AKTGDEL 581
                    ..|.|...:....|   ||..:.:|.....|.......:.||        |:..|:.
Mouse   195 PSVEGLNTPGKAAPAEVSSIIK---KKPNQAKKGLGAKKGSLGAQKLTNTSFTEIEKQAQAVDKR 256

  Fly   582 EDDDD-------DESI----NIPSMSLSISR--DDLLVIGDD--LALDRLE------TPGI---L 622
            ::.:|       :|||    .:....|.|||  |:.|.:...  :..:||.      ..||   :
Mouse   257 KEQEDLARGAPKEESIVSSLRLAYKDLEISRKKDERLNLSGQKKVEAERLGMGFGSCRSGISHSV 321

  Fly   623 GSDQESTDGESDA---------ESPEELPFSQ----LDANQLLYMASVVHNLPVMCMAFALGADK 674
            .||.::.:.||..         |.||:..||.    .:.:...|....:........::..|||.
Mouse   322 TSDMQTIEQESPTLAKPRRKYQEDPEDSYFSSSSKWSEQSSSRYFDDPMELRSSSFSSWDDGADS 386

  Fly   675 MWK-----NPQDRQRS 685
            .||     :|:...||
Mouse   387 YWKKDSSRDPEPAMRS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 38/128 (30%)
ANK 652..768 CDD:238125 9/39 (23%)
Ank_4 683..736 CDD:290365 2/3 (67%)
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Arfgap3NP_001344685.1 ArfGap 13..116 CDD:214518 35/102 (34%)
CDC27 <134..>292 CDD:312868 30/164 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..206 4/43 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..271 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.