Sequence 1: | NP_524458.1 | Gene: | CenB1A / 42735 | FlyBaseID: | FBgn0039056 | Length: | 828 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011527203.1 | Gene: | ARFGAP1 / 55738 | HGNCID: | 15852 | Length: | 416 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 50/207 - (24%) |
---|---|---|---|
Similarity: | 80/207 - (38%) | Gaps: | 67/207 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 393 NAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVV 457
Fly 458 NRIYEARIG-DDCGLKKPTEQCEIGVREAW-IKAKYVERRFVCGMPKPQELLASETAEVLSIDSG 520
Fly 521 GVVEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTLSDDPSIYN---------TAK 576
Fly 577 TGDELED--DDD 586 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CenB1A | NP_524458.1 | BAR_ACAPs | 18..217 | CDD:153287 | |
PH | 259..352 | CDD:278594 | |||
PH_ACAP | 260..355 | CDD:270070 | |||
ArfGap | 384..497 | CDD:279720 | 35/105 (33%) | ||
ANK | 652..768 | CDD:238125 | |||
Ank_4 | 683..736 | CDD:290365 | |||
ANK repeat | 687..713 | CDD:293786 | |||
ANK repeat | 715..746 | CDD:293786 | |||
ARFGAP1 | XP_011527203.1 | ArfGap | 7..114 | CDD:279720 | 36/145 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |