DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Agap3

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006236000.1 Gene:Agap3 / 362300 RGDID:1310751 Length:1093 Species:Rattus norvegicus


Alignment Length:239 Identity:80/239 - (33%)
Similarity:121/239 - (50%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 EGDRRFCFEVISPT-KSHILQADSADMLSLWISALQHSIGAAIQ-----HDSTHHSRPQSTNAPN 373
            |.:..|.|.|:|.| ::...:|.:|:...||:.::|..|.|::|     .|.|.... |||....
  Rat   784 ETEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGN-QSTALAV 847

  Fly   374 NSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTL 438
            .::...|           ||::|.||.:|.|.|||:|||..:||||||:||.||.|.|:||||.|
  Rat   848 QTVRTAR-----------GNSFCVDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDL 901

  Fly   439 DAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKP 503
            |.|..|.:.||..:||.:.|.::|..:.   |..||..:.....:|.||:|||.::.|:..:|..
  Rat   902 DDWPPELLAVMTAMGNALANSVWEGALD---GYSKPGPEACREEKERWIRAKYEQKLFLAPLPSS 963

  Fly   504 -----QELLASETAE-----VLSIDSGGVVEDGESGGSGIAKRA 537
                 |:||.:...:     |:.:..|...|..|:.|.|..:.|
  Rat   964 DVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTA 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594 11/37 (30%)
PH_ACAP 260..355 CDD:270070 12/40 (30%)
ArfGap 384..497 CDD:279720 48/112 (43%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Agap3XP_006236000.1 small_GTPase 309..474 CDD:197466
Centaurin_gamma 311..468 CDD:133303
PH_AGAP 584..827 CDD:241281 13/42 (31%)
PH 587..>648 CDD:278594
ArfGap 855..960 CDD:279720 49/107 (46%)
Ank_2 971..1061 CDD:289560 9/37 (24%)
ANK 971..>1060 CDD:238125 9/37 (24%)
ANK repeat 971..1001 CDD:293786 6/29 (21%)
ANK repeat 1003..1034 CDD:293786 1/5 (20%)
ANK repeat 1036..1061 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.