DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Arfgap2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006234592.1 Gene:Arfgap2 / 362162 RGDID:1306177 Length:534 Species:Rattus norvegicus


Alignment Length:81 Identity:38/81 - (46%)
Similarity:48/81 - (59%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PAKRRIH--WEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLD 439
            |:|..|.  ::....||.|..|.||.:..|.||||..|:.|||:|||||||||||.|.:||..||
  Rat     5 PSKSEIQTLFKRLRAIPTNKACFDCGAKSPSWASITYGVFLCIDCSGVHRSLGVHLSFIRSTELD 69

  Fly   440 A-WESENVKVMMELGN 454
            : |....::.|...||
  Rat    70 SNWSWLQLRCMQVGGN 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 35/72 (49%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Arfgap2XP_006234592.1 PLN03114 12..484 CDD:178661 35/74 (47%)
ArfGap 14..117 CDD:214518 35/72 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.