DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Git

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_610599.3 Gene:Git / 36122 FlyBaseID:FBgn0033539 Length:731 Species:Drosophila melanogaster


Alignment Length:480 Identity:108/480 - (22%)
Similarity:156/480 - (32%) Gaps:179/480 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 HSRPQS-TNAPNNSLP-AKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRS 425
            ||.|.: |.:..:.:| .|.|:..|         .|.||.:.:|.|||||.||.||.:|..||||
  Fly    23 HSDPATPTISTRSKMPRGKSRLQTE---------VCGDCGAGDPSWASINRGILLCADCCSVHRS 78

  Fly   426 LGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGD----DCGLK------KPTEQCEI 480
            ||.|.|.|:||....||...:..:..|.....|.::|..:.|    ..|.|      |||.:..:
  Fly    79 LGRHISIVKSLRQGNWEPSVLNFVNSLNAHGANSVWEHHLLDGSTNSTGGKHVPRWRKPTPKDAL 143

  Fly   481 -GVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGVVEDGESGGSGIAKRATLSLGGT 544
             ..:..:||||:|...||.   ||                                         
  Fly   144 HPTKSDFIKAKHVNLTFVL---KP----------------------------------------- 164

  Fly   545 RKWAVKKLRRRQKQRSIPKTLSDDPSIYNTAKTGDELEDDDDDESINIPSMSLSISRDDLLVIGD 609
                                               .|:|||                        
  Fly   165 -----------------------------------SLQDDD------------------------ 170

  Fly   610 DLALDRLETPGILGSDQESTDGESDAESPEELPFSQLDANQLLYMASVVHNLPVMCMAFALGADK 674
                                ||...|...|:      :.::.|:.:....||.........|||.
  Fly   171 --------------------DGNGSAGCLEQ------ELSRQLHASVRTSNLETSLRFLVQGADP 209

  Fly   675 MWKNPQDRQRSFLHQAVISGSVMACEFLLLNGAAIDAVDEMGYSALHISTAKGH--IAQVYLLLK 737
            .:.: :|:..:.||.|...|.....|.||:.||.::|:|..|.:.|.::.|..|  ||:..|   
  Fly   210 NYYH-EDKLSTPLHMAAKFGQASQIEMLLIYGADVNALDGNGMTPLELARANNHNTIAERLL--- 270

  Fly   738 HKAAYDLSSS-----DGKKALD-------IAVDQENADIVTLLRLTQLNDEIGPN--------DE 782
             .|.||::..     .|||. |       |..|...|||...|::.:...::.||        |.
  Fly   271 -DAMYDVTDRIITFLGGKKP-DHASGRHMIIPDANGADISEQLKIARGKLQLVPNKMFEELVMDL 333

  Fly   783 YNGEDETYKNVMKDFSKLPASQTRV 807
            |:..|......:...|.|.|....|
  Fly   334 YDEVDRRECEAIWSTSTLNADHATV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 42/123 (34%)
ANK 652..768 CDD:238125 37/129 (29%)
Ank_4 683..736 CDD:290365 18/54 (33%)
ANK repeat 687..713 CDD:293786 10/25 (40%)
ANK repeat 715..746 CDD:293786 10/32 (31%)
GitNP_610599.3 ArfGap 48..164 CDD:279720 43/118 (36%)
Ank_2 187..279 CDD:289560 28/96 (29%)
ANK <187..270 CDD:238125 24/83 (29%)
ANK repeat 187..213 CDD:293786 6/25 (24%)
ANK repeat 215..247 CDD:293786 11/31 (35%)
ANK repeat 249..279 CDD:293786 10/33 (30%)
GIT_SHD 314..342 CDD:285690 5/27 (19%)
GIT 374..404 CDD:128828
GIT1_C 609..727 CDD:289013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.