DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and drongo

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster


Alignment Length:435 Identity:78/435 - (17%)
Similarity:137/435 - (31%) Gaps:138/435 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 NAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVV 457
            |..|.||....|.:.::.:|..:|..||||.|.|...: :|:|:::..:..:.:..:...|||:.
  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH-RVKSISMATFTQDEIDFLRSHGNELC 90

  Fly   458 NRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGV 522
            .:.:       .||..|........:...:..||..:|:......|.:.||:......|..:...
  Fly    91 AKTW-------LGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNH 148

  Fly   523 VEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTLSDDPSIYNTAKTGDELEDDDDD 587
            .::|...|     .|::.|                         ..|:...|:..|  |:...:.
  Fly   149 TQNGHQNG-----YASIHL-------------------------TPPAAQRTSANG--LQKVANS 181

  Fly   588 ESINIPSMSLSISR-------------DDLLVIGDDLALDRLETPGILGSDQESTDGESDAESPE 639
            .|.:....|.||||             .|...:|.  .|..|.:.|     ..||...||..|  
  Fly   182 SSNSSGKTSSSISRPHYNHQNNSQNNNHDAFGLGG--GLSSLNSAG-----STSTGALSDTSS-- 237

  Fly   640 ELPFSQLDANQLLYMASVVHNLPVMCMAFALGADKMWKNPQDRQRSFLHQAVISGSVMACEFLLL 704
                                     |.:...|||                         |:|:..
  Fly   238 -------------------------CASNGFGAD-------------------------CDFVAD 252

  Fly   705 NGA---------------AIDAVDEM----GYSALHISTAKGHIAQVYLLLKHKAAYDLSSSDGK 750
            .|:               |:.:|..:    ||:.:....| .|:.|...|.:......|.:.:|.
  Fly   253 FGSANIFDATSARSTGSPAVSSVSSVGSSNGYAKVQPIRA-AHLQQQQQLQQQLHQQQLLNGNGH 316

  Fly   751 KALDIAVDQENADIVTLLRLTQLNDEI------GPNDEYNGEDET 789
            :..:...|.::|.|...:.....||.|      |.:|.::..|::
  Fly   317 QGTENFADFDHAPIYNAVAPPTFNDWISDWSRRGFHDPFDDCDDS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 24/103 (23%)
ANK 652..768 CDD:238125 20/134 (15%)
Ank_4 683..736 CDD:290365 10/71 (14%)
ANK repeat 687..713 CDD:293786 4/40 (10%)
ANK repeat 715..746 CDD:293786 7/34 (21%)
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 24/106 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.