DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and AGFG2

DIOPT Version :10

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_005250363.1 Gene:AGFG2 / 3268 HGNCID:5177 Length:492 Species:Homo sapiens


Alignment Length:172 Identity:35/172 - (20%)
Similarity:66/172 - (38%) Gaps:53/172 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PLIQFYAITWIKEFVQLSGGEILCFASGIFTAILPCLAFESDAKKNIKDCANAVNLHLLELISSG 335
            |.|:|       :|.||:|  :|..|..|...|:..|......:.|::|...|..|..|..:..|
Human   296 PEIRF-------QFPQLTG--VLTLAFFIHNCIITLLKNNKKQENNVRDLCIAYMLVTLTYLYIG 351

  Fly   336 --------------EDKQKNLSYLD-------LNSVMEV--LRQYLVHSPVPTKIAVLKWVHHLF 377
                          :..::|  :||       |:.:..:  |.|.:...|:...:|.::.:.|:|
Human   352 VLVFASFPSPPLSKDCIEQN--FLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLGHIF 414

  Fly   378 TEVHDEMSEHANKLFPVLLRDCLSDSSDEVVLQAIVVLAEIV 419
            .:::.       .:|.||            :|..|:|.|.::
Human   415 GDIYP-------SIFHVL------------ILNLIIVGAGVI 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH_ACAP 260..355 CDD:270070 22/106 (21%)
ArfGap_ACAP 381..497 CDD:350064 7/39 (18%)
ANKYR <647..>768 CDD:440430
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
AGFG2XP_005250363.1 ArfGap_AGFG2 30..146 CDD:350090
PHA03247 <160..446 CDD:223021 35/172 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.