DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Agap1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_038939665.1 Gene:Agap1 / 316611 RGDID:1309244 Length:1428 Species:Rattus norvegicus


Alignment Length:252 Identity:83/252 - (32%)
Similarity:130/252 - (51%) Gaps:31/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 RICSVRPV--------NEGDRRFCFEVISPT-KSHILQADSADMLSLWISALQHSIGAAIQHDST 361
            |:.|:|.:        .|.:....|.::|.| ::...:|.:.:....|:.|::..|.|::|  |.
  Rat  1103 RVGSLRNIYSSSSTNTEEQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ--SC 1165

  Fly   362 HHSRPQSTNAPNNSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSL 426
            ..|:.:|.....:...|.:.|.     .:.||::|.||.:..|.|||:|||..:||||||:||:|
  Rat  1166 ESSKNKSRLTSQSEAMALQSIR-----NMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNL 1225

  Fly   427 GVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKY 491
            |.|.|:||||.||.|..|.:|||..:|||:.|.::|.  |.. |..||:.......:|.||:|||
  Rat  1226 GTHLSRVRSLDLDDWPMELIKVMSSIGNELANSVWEE--GSQ-GRTKPSLDSTREEKERWIRAKY 1287

  Fly   492 VERRFVCGMP-----KPQELLASETAE------VLSIDSGGVVEDGESGGSGIAKRA 537
            .::.|:..:|     ..|:||.: |||      :|.:..|...|..|:.|.|..:.|
  Rat  1288 EQKLFLAPLPCTEFSLGQQLLHA-TAEEDLRTVILLLAHGSRDEVNETCGEGDGRTA 1343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594 10/54 (19%)
PH_ACAP 260..355 CDD:270070 11/57 (19%)
ArfGap 384..497 CDD:279720 50/112 (45%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Agap1XP_038939665.1 Centaurin_gamma 561..722 CDD:133303
PH_AGAP 837..>911 CDD:241281
PH-like <1123..1163 CDD:418428 8/39 (21%)
ArfGap_AGAP2 1180..1288 CDD:350078 51/115 (44%)
ANK repeat 1304..1332 CDD:293786 9/28 (32%)
Ank_2 1307..1397 CDD:403870 12/38 (32%)
ANK repeat 1339..1370 CDD:293786 1/5 (20%)
ANK repeat 1372..1397 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.