DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Smap2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001094139.1 Gene:Smap2 / 298500 RGDID:1308418 Length:428 Species:Rattus norvegicus


Alignment Length:298 Identity:88/298 - (29%)
Similarity:139/298 - (46%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 NAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVV 457
            |.:|.||:|..|||||.|:|:.:||.|:|:||:||||.|:|:|:.||.|..|.::.|.|:||...
  Rat    25 NKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKA 89

  Fly   458 NRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGV 522
            ||:|||.:.:.....:.....|..:|:.:.|.||::|.....:.:.::                 
  Rat    90 NRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINVLRKEK----------------- 137

  Fly   523 VEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQK-------QRSIPKTLS--------DDP--- 569
             :|....||..|....:     .....:|::..||       ::|.||:.:        |.|   
  Rat   138 -DDKWKRGSEPAPEKKM-----EPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGLDAPVAC 196

  Fly   570 SIYNTAKTGDELEDDDDDESINIPSMSLSISRDDLLVIGDDLALDRLETPGILGSDQESTD--GE 632
            ||.| :||.:.|| .|.|...::||.| |:||.         |:..:.|.|..||..|:.:  .|
  Rat   197 SIAN-SKTSNALE-KDLDLLASVPSPS-SVSRK---------AVGSMPTAGSAGSVPENLNLFPE 249

  Fly   633 SDAESPEELPFSQLDANQLLYM-ASVVHNLPVMCMAFA 669
            ..::| ||....||..:.:|.: .|....:|...|..|
  Rat   250 PGSKS-EETGKKQLSKDSILSLYGSQTPQMPAQAMFMA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 44/103 (43%)
ANK 652..768 CDD:238125 5/19 (26%)
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Smap2NP_001094139.1 ArfGap_SMAP2 16..122 CDD:350083 41/96 (43%)
PBP1 <102..419 CDD:227507 50/221 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.