DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Appl1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_038951064.1 Gene:Appl1 / 290537 RGDID:1309388 Length:720 Species:Rattus norvegicus


Alignment Length:491 Identity:111/491 - (22%)
Similarity:206/491 - (41%) Gaps:84/491 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEFEECLKDSPRFRQFVSKEESDIEHLEQRLEKIIKLCNVAVDSGKEYVKNQSAFAMSL------ 63
            :..||.|:|||:.|..:...|.|...:...:.::.:..:...|:     :|:.:.|..|      
  Rat     7 LPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDA-----QNELSAATHLTSKLLK 66

  Fly    64 -WDLQQHFL--DNKNAHNALGKLIHCFQEMNKFHTILLDQASRTVLKNLSVFVKDDINQVKDYKG 125
             ::.|:..|  |::...:.|.:......|::..|.:|..|.:..::..:|.|.:.|:.::...|.
  Rat    67 EYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKERDLKEILTLKE 131

  Fly   126 HFLKVSEGYDNALIKNAQASKNRPQE--MQEAANILSASKSCFQHTALDYVNYITLAQARKVPSI 188
            .|...|..:|.|:.:.::.||.|..:  ..|....:..|:.....|.:.|...:...|.:|..::
  Rat   132 VFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIAL 196

  Fly   189 LSTLLDYYQACVTYYHQGFDLCN-DFDEFFKNISEDLNALR----GDYQQLEKAMQNRHMS---- 244
            |..||.|.||.::::..|.:..| ..:||..||...:..:|    ||.:.:::.:::..::    
  Rat   197 LEPLLGYMQAQISFFKMGSENLNGQLEEFLANIGTSVQNVRREMDGDVETMQQTIEDLEVASDPL 261

  Fly   245 -----------VNRYCDSNTNSTSNKIEGYLFKKKSKGF--KTWCRRWFYLSDNQLVYRKRSNED 296
                       |||      |.|  :..|||..:...|.  .||.|::::.....|:.:.|.  |
  Rat   262 YLPDPDPTKFPVNR------NLT--RKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARG--D 316

  Fly   297 SFSVMEEDLRICSVRPVNEGDRRFCFEVIS--PTKSHILQADSADMLSLWISALQHSIGAAIQHD 359
            ....:..|:..|||..|:..|||:||::.|  ..||.||||:|......||..:.:     |...
  Rat   317 VAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINN-----ISKQ 376

  Fly   360 STHHSRPQSTNAPNNS--------LPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLC 416
            ......|:.|.|..|.        .|:.::.|  |.|: ||.    ..|.|..|.:|        
  Rat   377 IYLSENPEETAARVNQSALEAVTPSPSFQQRH--ESLR-PGG----QSRPPTARTSS-------- 426

  Fly   417 IECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMEL 452
               ||   |||...:.:.:|:||:..:.:..:..::
  Rat   427 ---SG---SLGSESTNLAALSLDSLVAPDTPIQFDI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 41/210 (20%)
PH 259..352 CDD:278594 30/96 (31%)
PH_ACAP 260..355 CDD:270070 30/98 (31%)
ArfGap 384..497 CDD:279720 16/69 (23%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Appl1XP_038951064.1 BAR_APPL1 20..234 CDD:153315 44/218 (20%)
BAR-PH_APPL 252..376 CDD:270067 36/138 (26%)
PTB_APPL 506..637 CDD:269980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.