DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and APPL1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_036228.1 Gene:APPL1 / 26060 HGNCID:24035 Length:709 Species:Homo sapiens


Alignment Length:491 Identity:107/491 - (21%)
Similarity:204/491 - (41%) Gaps:83/491 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IEFEECLKDSPRFRQFVSKEESDIEHLEQRLEKIIKLCNVAVDSGKEYVKNQSAFAMSL------ 63
            :..||.|:|||:.|..:...|.|...:...:.::.:..:...|:     :|:.:.|..|      
Human     7 LPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDA-----QNELSAATHLTSKLLK 66

  Fly    64 -WDLQQHFL--DNKNAHNALGKLIHCFQEMNKFHTILLDQASRTVLKNLSVFVKDDINQVKDYKG 125
             ::.|:..|  |::...:.|.:......|::..|.:|..|.:..::..::.|.:.|:.::...|.
Human    67 EYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKE 131

  Fly   126 HFLKVSEGYDNALIKNAQASKNRPQE--MQEAANILSASKSCFQHTALDYVNYITLAQARKVPSI 188
            .|...|..:|.|:.:.::.||.|..:  ..|....:..|:.....|.:.|...:...|.:|..::
Human   132 VFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIAL 196

  Fly   189 LSTLLDYYQACVTYYHQGFDLCND-FDEFFKNISEDLNALR----GDYQQLEKAMQNRHMS---- 244
            |..||.|.||.::::..|.:..|: .:||..||...:..:|    .|.:.:::.:::..::    
Human   197 LEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPL 261

  Fly   245 -----------VNRYCDSNTNSTSNKIEGYLFKKKSKGF--KTWCRRWFYLSDNQLVYRKRSNED 296
                       |||      |.|  :..|||..:...|.  .||.|::::.....|:.:.|.  |
Human   262 YVPDPDPTKFPVNR------NLT--RKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARG--D 316

  Fly   297 SFSVMEEDLRICSVRPVNEGDRRFCFEVIS--PTKSHILQADSADMLSLWISALQHSIGAAIQHD 359
            ....:..|:..|||..|:..|||:||::.|  ..||.||||:|......||..:.:     |...
Human   317 VAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKKDHEEWICTINN-----ISKQ 376

  Fly   360 STHHSRPQSTNAPNNS--------LPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLC 416
            ......|:.|.|..|.        .|:.::.| |......|.:     |.|..|.:|        
Human   377 IYLSENPEETAARVNQSALEAVTPSPSFQQRH-ESLRPAAGQS-----RPPTARTSS-------- 427

  Fly   417 IECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMEL 452
               ||   |||...:.:.:|:||:..:.:..:..::
Human   428 ---SG---SLGSESTNLAALSLDSLVAPDTPIQFDI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 40/210 (19%)
PH 259..352 CDD:278594 30/96 (31%)
PH_ACAP 260..355 CDD:270070 30/98 (31%)
ArfGap 384..497 CDD:279720 14/69 (20%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
APPL1NP_036228.1 Required for RAB5A binding 1..428 99/457 (22%)
BAR_APPL1 20..234 CDD:153315 43/218 (20%)
BAR-PH_APPL 252..376 CDD:270067 36/138 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..434 13/56 (23%)
F&H 403..414 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..491
PTB_APPL 490..625 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..709
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.