Sequence 1: | NP_524458.1 | Gene: | CenB1A / 42735 | FlyBaseID: | FBgn0039056 | Length: | 828 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006235793.1 | Gene: | Arfgap1 / 246310 | RGDID: | 708452 | Length: | 425 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 57/205 - (27%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 62/205 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 393 NAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVV 457
Fly 458 NRIYEARIGDDCGLKKPTEQCEIGVREAW-IKAKYVERRFVCGMPKPQELLASETAEVLSIDSGG 521
Fly 522 VVEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTL-------SDDPSIYNTAKTGD 579
Fly 580 ELEDD--DDD 587 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CenB1A | NP_524458.1 | BAR_ACAPs | 18..217 | CDD:153287 | |
PH | 259..352 | CDD:278594 | |||
PH_ACAP | 260..355 | CDD:270070 | |||
ArfGap | 384..497 | CDD:279720 | 36/104 (35%) | ||
ANK | 652..768 | CDD:238125 | |||
Ank_4 | 683..736 | CDD:290365 | |||
ANK repeat | 687..713 | CDD:293786 | |||
ANK repeat | 715..746 | CDD:293786 | |||
Arfgap1 | XP_006235793.1 | ArfGap | 7..114 | CDD:279720 | 40/142 (28%) |
DUF4048 | <325..376 | CDD:289997 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |