DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Adap1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_766311.2 Gene:Adap1 / 231821 MGIID:2442201 Length:374 Species:Mus musculus


Alignment Length:381 Identity:95/381 - (24%)
Similarity:158/381 - (41%) Gaps:90/381 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 LPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDA 440
            :..:||....|.|..|||..|.||.:|:|.|||..||:.:|:.|||:||:: ...|||:|:.|||
Mouse     1 MAGERRRALLELLTRPGNTRCADCGAPDPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVRLDA 64

  Fly   441 WESENVKVMMELGNEVVNRIYEARIGDDCGLKKPT-EQCEIGVREAWIKAKYVERRFVCGMPKPQ 504
            |:...|:.|...|||.....:|:::..  ...:|| ..|:: :||.||:|||..:.||  ..:.|
Mouse    65 WDEAQVEFMASHGNEAARATFESKVPP--FYYRPTFSDCQL-LREQWIRAKYERQEFV--HVEKQ 124

  Fly   505 ELLASETAEVLSIDSGGVVEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTLSDDP 569
            |..::...|      |.:.:.|...|..::::..|:   .|:.|:|...:...:.  ||.:....
Mouse   125 EPYSTGYRE------GLLWKRGRDNGQFLSRKFVLT---EREGALKYFNKNDAKE--PKAVMKIE 178

  Fly   570 SI---YNTAKTGDE-------LEDD---------DDDESINIPSMSLSISRDDLLVIGDDLALDR 615
            .:   :..||.|..       |:|:         :|.:.|.....:|..:|...|.:....|.|.
Mouse   179 HLNATFQPAKMGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGASDA 243

  Fly   616 LETPGILGSDQESTDGESDAESPEELP-----FSQLDANQLLYMASVVHNLPVMCMAFALGADKM 675
            ...|.:  |.....:|..:...|::..     :..:|..:|:|                      
Mouse   244 DLVPKL--SRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMY---------------------- 284

  Fly   676 WKNPQDRQRSFLHQAVISGSVMACEFLLLNGAAIDAVDEMGYSALH---ISTAKGH 728
            :|:|.|   :|....|..||                 .|.||:.|.   :|| :||
Mouse   285 FKDPLD---AFARGEVFIGS-----------------KESGYTVLEGLPLST-QGH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 45/113 (40%)
ANK 652..768 CDD:238125 16/80 (20%)
Ank_4 683..736 CDD:290365 12/49 (24%)
ANK repeat 687..713 CDD:293786 3/25 (12%)
ANK repeat 715..746 CDD:293786 7/17 (41%)
Adap1NP_766311.2 ArfGap 10..126 CDD:214518 48/121 (40%)
PH1_ADAP 130..238 CDD:270072 20/118 (17%)
PH2_ADAP 252..357 CDD:241282 20/111 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.