DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Adap2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_742145.1 Gene:Adap2 / 216991 MGIID:2663075 Length:381 Species:Mus musculus


Alignment Length:208 Identity:60/208 - (28%)
Similarity:89/208 - (42%) Gaps:56/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 GNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEV 456
            ||.:|.||.:.:|.|||..|||.:|:.||||||:. ...|||:|:.||.|:...|:.|...||..
Mouse    21 GNGHCADCGAADPDWASYKLGIFICLHCSGVHRNF-PDISKVKSVRLDFWDDSMVEFMTHHGNLN 84

  Fly   457 VNRIYEARI--------GDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELLASETAE 513
            |...:|||:        .:||          :.::|.||:|||                  |..|
Mouse    85 VKAKFEARVPAFYYVPQANDC----------LVLKEQWIRAKY------------------ERQE 121

  Fly   514 VLSID---------SGGVVEDGESGGSGIAKR-ATLSLGGTRKWAVKKLRRRQKQRSIPK---TL 565
            ..:||         .|.:.:.|......:.:| ..||..|..|:..|      ::...||   ::
Mouse   122 FTAIDKAVSHPGNREGFLWKRGRDNAQFLRRRFVLLSREGLLKYYTK------EEGKAPKAVISI 180

  Fly   566 SDDPSIYNTAKTG 578
            .|..:.:.|.|.|
Mouse   181 KDLNATFQTEKIG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 42/112 (38%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Adap2NP_742145.1 ArfGap 9..123 CDD:279720 44/130 (34%)
PH1_ADAP 133..241 CDD:270072 14/67 (21%)
PH 135..231 CDD:278594 14/65 (22%)
PH2_ADAP 255..362 CDD:241282
PH 258..361 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.