DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Agap2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006513621.1 Gene:Agap2 / 216439 MGIID:3580016 Length:1342 Species:Mus musculus


Alignment Length:273 Identity:84/273 - (30%)
Similarity:126/273 - (46%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 STSNKIEGYLFKKKSKGFKTWCRRWFYLSDNQLVYRKRSNEDSFSVMEEDLRICSVRPVNEGDRR 319
            ||.:|.||...:.::|                   ||.....||.         |:|.:.:.:..
Mouse   833 STPSKTEGSAVQAEAK-------------------RKMWKLKSFG---------SLRNIYKAEEN 869

  Fly   320 FCFEVISPT-KSHILQADSADMLSLWISALQHSIGAAIQ--HDSTHHSRPQSTNAPNNSLPAKRR 381
            |.|.::|.| ::...:|.|.:....|:.|::..|.|::|  ..|....|..|.:         ..
Mouse   870 FEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSKVKLRTDSQS---------EA 925

  Fly   382 IHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENV 446
            :..:......||:.|.||.:|.|.|||:|||..:||||||:||:||.|.|:||||.||.|..|..
Mouse   926 VAIQAIRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELT 990

  Fly   447 KVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELL---- 507
            .|:..:||:..||::|:   |..|..|||.......||:||:|||.:..|:..:...:|.|    
Mouse   991 LVLTAIGNDTANRVWES---DTRGRAKPTRDSSREERESWIRAKYEQLLFLAPLGTTEEPLGRQL 1052

  Fly   508 -----ASETAEVL 515
                 |.:.|.||
Mouse  1053 WAAVEAQDVAAVL 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594 18/93 (19%)
PH_ACAP 260..355 CDD:270070 18/95 (19%)
ArfGap 384..497 CDD:279720 51/112 (46%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Agap2XP_006513621.1 PHA03247 <52..320 CDD:223021
Centaurin_gamma 401..560 CDD:133303
PH_AGAP 668..908 CDD:241281 22/102 (22%)
ArfGap_AGAP 926..1033 CDD:350065 50/109 (46%)
SelP_N <1136..1188 CDD:368014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.