DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and Agfg1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_006496493.1 Gene:Agfg1 / 15463 MGIID:1333754 Length:577 Species:Mus musculus


Alignment Length:170 Identity:43/170 - (25%)
Similarity:81/170 - (47%) Gaps:29/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 AKRRIHWEEFLK-------IPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRS 435
            |||: ..|:.||       :|.|..|.||....|.:.::.:|..:|..|||..|.|...: :|:|
Mouse     5 AKRK-QEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPH-RVKS 67

  Fly   436 LTLDAWESENVKVMMELGNEVVNRIYEARIG--DDCGLKKPTEQCEIGVREAWIKAKYVERRFVC 498
            :::..:..:.::.:.:.||||..:|:   :|  ||.....|..:....|:| :::.||.::|:..
Mouse    68 ISMTTFTQQEIEFLQKHGNEVCKQIW---LGLFDDRSSAIPDFRDPQKVKE-FLQEKYEKKRWYV 128

  Fly   499 GMPKPQELLASETAEVLSIDSGGVVEDGESGGSGIAKRAT 538
             .|:..:::||..|.:             ||.|..:..:|
Mouse   129 -PPEQAKVVASVHASI-------------SGSSASSTSST 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 32/121 (26%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Agfg1XP_006496493.1 COG5347 8..268 CDD:227651 40/167 (24%)
ArfGap_AGFG1 13..128 CDD:350082 31/119 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.