DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and AGAP3

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_114152.3 Gene:AGAP3 / 116988 HGNCID:16923 Length:911 Species:Homo sapiens


Alignment Length:234 Identity:77/234 - (32%)
Similarity:123/234 - (52%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 EGDRRFCFEVISPT-KSHILQADSADMLSLWISALQHSIGAAIQHDSTHHSRPQSTNAPNNSLPA 378
            |.:..|.|.|:|.| ::...:|.:|:...||:.::|..|.|::|  ....::.::.....|:..|
Human   602 EAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ--GCRSAKDKTRLGNQNAALA 664

  Fly   379 KRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWES 443
            .:.:.     .:.||::|.||.:|.|.|||:|||..:||||||:||.||.|.|:||||.||.|..
Human   665 VQAVR-----TVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPP 724

  Fly   444 ENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKP----- 503
            |.:.||..:||.:.|.::|..:|   |..||........:|.||:|||.::.|:..:|..     
Human   725 ELLAVMTAMGNALANSVWEGALG---GYSKPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLG 786

  Fly   504 QELLASETAE-----VLSIDSGGVVEDGESGGSGIAKRA 537
            |:||.:...:     |:.:..|...|..|:.|.|..:.|
Human   787 QQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTA 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594 11/37 (30%)
PH_ACAP 260..355 CDD:270070 12/40 (30%)
ArfGap 384..497 CDD:279720 49/112 (44%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
AGAP3NP_114152.3 small_GTPase 126..291 CDD:197466
Centaurin_gamma 128..285 CDD:133303
PH_AGAP 401..645 CDD:241281 13/42 (31%)
PH 404..>465 CDD:278594
ArfGap 664..778 CDD:279720 51/121 (42%)
Ank_2 789..879 CDD:289560 9/37 (24%)
ANK 789..>878 CDD:238125 9/37 (24%)
ANK repeat 789..819 CDD:293786 6/29 (21%)
ANK repeat 821..852 CDD:293786 1/5 (20%)
ANK repeat 854..879 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R258
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.