DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and ARAP2

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_056045.2 Gene:ARAP2 / 116984 HGNCID:16924 Length:1704 Species:Homo sapiens


Alignment Length:550 Identity:134/550 - (24%)
Similarity:230/550 - (41%) Gaps:139/550 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LEQRLEKIIK--LCNVAVDSGKEYVKNQSAFAMSLWDLQQHFLDNKNAHNALGKLIHCF---QEM 90
            |.||||...|  :.|..:..| |.:|.::|.|.:.:.::....||:....:..|:...:   ::.
Human   339 LFQRLENSKKRSIKNEFLTQG-EALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDK 402

  Fly    91 NKFHTILLDQASRTVLKNLSVFVKDDINQVKDYKGHFLKVSEGYDNALIKNAQASKNRPQEMQEA 155
            |.|   |:|.||                     :..:..|.|.:.:...||::|||:|.|:    
Human   403 NNF---LIDTAS---------------------ESEYSTVEECFQSLRRKNSKASKSRTQK---- 439

  Fly   156 ANIL---------------SASKSCFQHTALDYVNYITLAQARKVPS-------------ILSTL 192
            |.||               :|..|.....|:........|.|:||.|             .....
Human   440 ALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASAKKVKSGWLDKLSPQGKRMFQKRW 504

  Fly   193 LDYYQACVTYYHQGFDLCNDFDEFFKNISEDLNAL-----RGDYQ------------QLEKAMQ- 239
            :.:....::||:      |:.:.:.|.|. .|:|:     :||.:            ::||..: 
Human   505 VKFDGLSISYYN------NEKEMYSKGII-PLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEEER 562

  Fly   240 NRHMSV--NRYCDSNTNSTSNKIE-----GYLFKKKSKGFKTWCRRWFYLSDNQLVYRKRSNEDS 297
            |..:|:  |.....:..|.|..:.     |||   :.:|:|  .:.:..||.|. |:..::.:|.
Human   563 NDWISILLNALKSQSLTSQSQAVVTPEKCGYL---ELRGYK--AKIFTVLSGNS-VWLCKNEQDF 621

  Fly   298 FSVMEEDLRICSVRPVNEGDR--RFCFEVISPTKSHILQADSADMLSLWISALQHSIGAAIQHDS 360
            .|.:...:...:|..|.:.||  :..||:|:|.:|....|::......||.|:|.||...:    
Human   622 KSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAVQQSIAETL---- 682

  Fly   361 THHSRPQSTNAPNNSLPAKRRIHWEEFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRS 425
                         :......:|.:.|     .|..|.||::|:|.||||||.:.:|.:|:|.|||
Human   683 -------------SDYEVAEKIWFNE-----SNRSCADCKAPDPDWASINLCVVICKKCAGQHRS 729

  Fly   426 LGVHYSKVRSLTLDA--WESENVKVMMELGNEVVNRIYEARI--GDDCGLKKPTEQCEIGVREAW 486
            ||...||||||.:||  |.:|.:::.:.:||:..|..:...:  .::..:..|.|:     |:.:
Human   730 LGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEK-----RKNF 789

  Fly   487 IKAKYVERRFVCGMPKPQELLASETAEVLS 516
            |..||.|.:|      .:.||||.|.|.|:
Human   790 ITQKYKEGKF------RKTLLASLTKEELN 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 44/218 (20%)
PH 259..352 CDD:278594 25/99 (25%)
PH_ACAP 260..355 CDD:270070 27/101 (27%)
ArfGap 384..497 CDD:279720 41/116 (35%)
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
ARAP2NP_056045.2 SAM_Arap1,2,3 6..68 CDD:188889
SAM 13..65 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..161
PH1_ARAP 484..576 CDD:270073 16/98 (16%)
PH 484..574 CDD:278594 16/96 (17%)
PH 588..679 CDD:278594 26/96 (27%)
PH2_ARAP 588..675 CDD:270074 24/92 (26%)
ArfGap 686..801 CDD:279720 43/130 (33%)
PH3_ARAP 892..1002 CDD:270076
PH 921..998 CDD:278594
PH4_ARAP 1015..1110 CDD:270077
RhoGAP_ARAP 1114..1293 CDD:239850
UBQ 1330..1417 CDD:294102
PH5_ARAP 1423..1543 CDD:270079
PH 1436..1537 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1636..1675
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.