DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and ADAP1

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001271237.1 Gene:ADAP1 / 11033 HGNCID:16486 Length:385 Species:Homo sapiens


Alignment Length:382 Identity:92/382 - (24%)
Similarity:158/382 - (41%) Gaps:95/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 PAKRRIHWEEFLKIPGNAYCCD----CRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLT 437
            ||:|:  |:||.|:.|   |.:    ....:|.|||..||:.:|:.|||:||:: ...|||:|:.
Human    14 PARRK--WKEFEKMLG---CAEEGHASLGRDPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVR 72

  Fly   438 LDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPK 502
            |||||...|:.|...||:.....:|:::........|:: |:: :||.||:|||..:.|:  .|:
Human    73 LDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSD-CQL-LREQWIRAKYERQEFI--YPE 133

  Fly   503 PQELLASETAEVLSIDSGGVVEDGESGGSGIAKRATLSLGGTRKWAVKKLRRRQKQRSIPKTLSD 567
            .||..::...|      |.:.:.|...|..::::..|:   .|:.|:|...|...:.  ||.:..
Human   134 KQEPYSAGYRE------GFLWKRGRDNGQFLSRKFVLT---EREGALKYFNRNDAKE--PKAVMK 187

  Fly   568 DPSI---YNTAKTGDE-------LEDD---------DDDESINIPSMSLSISRDDLLVIGDDLAL 613
            ...:   :..||.|..       |:|:         :|.:.|.....:|..:|...|.:....|.
Human   188 IEHLNATFQPAKIGHPHGLQVTYLKDNSTRNIFIYHEDGKEIVDWFNALRAARFHYLQVAFPGAS 252

  Fly   614 DRLETPGILGSDQESTDGESDAESPEELP-----FSQLDANQLLYMASVVHNLPVMCMAFALGAD 673
            |....|.:  |.....:|..:...|::..     :..:|..:|:|                    
Human   253 DADLVPKL--SRNYLKEGYMEKTGPKQTEGFRKRWFTMDDRRLMY-------------------- 295

  Fly   674 KMWKNPQDRQRSFLHQAVISGSVMACEFLLLNGAAIDAVDEMGYSALH--ISTAKGH 728
              :|:|.|   :|....|..||                 .|.||:.||  ..:.:||
Human   296 --FKDPLD---AFARGEVFIGS-----------------KESGYTVLHGFPPSTQGH 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 41/116 (35%)
ANK 652..768 CDD:238125 15/79 (19%)
Ank_4 683..736 CDD:290365 11/48 (23%)
ANK repeat 687..713 CDD:293786 3/25 (12%)
ANK repeat 715..746 CDD:293786 6/16 (38%)
ADAP1NP_001271237.1 ArfGap 28..137 CDD:214518 39/113 (35%)
PH1_ADAP 141..249 CDD:270072 21/118 (18%)
PH 142..239 CDD:278594 19/107 (18%)
PH2_ADAP 263..368 CDD:241282 19/110 (17%)
PH 266..366 CDD:278594 19/107 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.