DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenB1A and acap2b

DIOPT Version :9

Sequence 1:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001096109.1 Gene:acap2b / 100124613 ZFINID:ZDB-GENE-050208-640 Length:264 Species:Danio rerio


Alignment Length:275 Identity:97/275 - (35%)
Similarity:159/275 - (57%) Gaps:16/275 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRATIEFEECLKDSPRFRQFVSKEESDIEHLEQRLEKIIKLCNVAVDSGKEYVKNQSAFAMSLWD 65
            |:.|::||||||||||||..:.:.|.|:..||.:|:|::|||...:|:||.|......|...:.:
Zfish     1 MKITVDFEECLKDSPRFRATIEEVEGDVCELESKLDKLVKLCIGMIDAGKAYNTANKQFVSGIRE 65

  Fly    66 LQQHFLDNKNAHNALGKLIHCFQEMNKFHTILLDQASRTVLKNLSVFVKDDINQVKDYKGHFLKV 130
            |.|....:....::|.......|||..:||||.|||.|::...|..|:::|:.:.|:.|..|.||
Zfish    66 LAQQSATDDVIESSLSTFAENLQEMINYHTILFDQAQRSIKSQLQTFIREDLRKFKEAKKQFDKV 130

  Fly   131 SEGYDNALIKNAQASKNRPQEMQEAANILSASKSCFQHTALDYVNYITLAQARKVPSILSTLLDY 195
            ||..:.||.|||||.:|:..|::||:|||:|::.||:|..||||..|.:.|:::...||.::|.:
Zfish   131 SEEKEAALSKNAQAPRNKAHEVEEASNILNATRKCFRHIVLDYVLQINVLQSKRRSEILKSMLSF 195

  Fly   196 YQACVTYYHQGFDLCNDFDEFFKNISEDLNALRGDYQQLEKAMQNRHMSVNRYCDSNTNSTSNKI 260
            ..|.:|::|||:||.::.....|.::..|:.|..|..:..|.|:.:|.::.:           |:
Zfish   196 MYAHLTFFHQGYDLFSELQPLMKQLTGQLDQLVLDATKERKDMETKHSTIQQ-----------KV 249

  Fly   261 EGYLFKKKSKGFKTW 275
            :.:|     :|...|
Zfish   250 KDFL-----RGVNFW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 73/198 (37%)
PH 259..352 CDD:278594 4/17 (24%)
PH_ACAP 260..355 CDD:270070 3/16 (19%)
ArfGap 384..497 CDD:279720
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
acap2bNP_001096109.1 BAR 18..217 CDD:299863 73/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3448
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 539 1.000 Inparanoid score I1149
OMA 1 1.010 - - QHG55583
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 1 1.000 - - FOG0000653
OrthoInspector 1 1.000 - - otm24348
orthoMCL 1 0.900 - - OOG6_101039
Panther 1 1.100 - - O PTHR23180
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X412
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.