DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and RASSF2

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_011527712.1 Gene:RASSF2 / 9770 HGNCID:9883 Length:328 Species:Homo sapiens


Alignment Length:274 Identity:87/274 - (31%)
Similarity:148/274 - (54%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 QRYIQIQMDCYPKENVAAASEGESSRADAPSITSGAAAGDEL--------------TQTEDLYTA 600
            :|.|::||            :.::.|...|..:|...:|..|              .|..::...
Human    63 RRPIRLQM------------QDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAP 115

  Fly   601 SEGVDGPDGDG--SAGLH-VTEDGVVLRRPPRTGASAIKRRSGNRRSRTKLKR----RCSINGHY 658
            .||...|...|  |.||. :.||...|.   ||.:....||.||.|:.:..:|    |.|||||:
Human   116 PEGDQMPSSTGTYSRGLKPLQEDTPQLM---RTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHF 177

  Fly   659 YNRETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKDDEY 723
            ||.:||.|||.|||..:|.::|.:||.:|:.|:|.|:|:::|...|:|::|..:||:::||..:|
Human   178 YNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY 242

  Fly   724 PLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAKIKERY 788
            |||.|:..||.|.::::||::..:.:|::.:|||::...:|..::.:::..:|..|||.|:..:|
Human   243 PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKKLMRKY 307

  Fly   789 AELRRRIVSRMESL 802
            ..||..|..|:|.:
Human   308 TVLRLMIRQRLEEI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 36/83 (43%)
Nore1-SARAH 762..799 CDD:293125 10/36 (28%)
RASSF2XP_011527712.1 rasfadin_RA 179..265 CDD:176379 36/85 (42%)
Nore1-SARAH 279..318 CDD:293125 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157837
Domainoid 1 1.000 80 1.000 Domainoid score I8603
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043350at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41862
orthoMCL 1 0.900 - - OOG6_105083
Panther 1 1.100 - - LDO PTHR22738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5365
SonicParanoid 1 1.000 - - X2208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.