DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and rassf3

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_005164556.1 Gene:rassf3 / 792539 ZFINID:ZDB-GENE-100422-9 Length:397 Species:Danio rerio


Alignment Length:285 Identity:63/285 - (22%)
Similarity:110/285 - (38%) Gaps:83/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 QIQMDCYP-------------------KENVAAASEGESSRADAPSITSGAAAGDELTQTEDLYT 599
            |:.:||:.                   ..|.|:.|:.|..:.....:|.     :|:.|..|.|.
Zfish   153 QVALDCHQSGSAHLNGVQLSFLAQDQLNNNQASHSDVEKEKELRTHLTF-----EEIRQKVDRYN 212

  Fly   600 ASEGVDGPD---------GDGSAGLHVTEDGVVLRRPPRT---GASAIKRRSGNRRSRTKLKRRC 652
            .    |..|         |..:..::|..|   ||||...   ||..:|.:..            
Zfish   213 R----DSRDFYKMSLSSSGTYTGFINVQMD---LRRPITVKGGGAGGVKAKEA------------ 258

  Fly   653 SINGHYYNRETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSL---FIVRDNGE 714
                         |..|.||..::.:|:..|..:||..:|:|:.|..:|..|:|   |...|...
Zfish   259 -------------FYLPRGSINTLHISNSNTVRQVIEALLKKFTVADNPAKFALYKRFSREDQVY 310

  Fly   715 QKRLKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR---AILERYDQE 776
            ..:|.::|:||..|:..||:.|... |::..::|.|:..:.     .|:||.:   .|||:.:|:
Zfish   311 TCKLSEEEHPLFLRLVAGPNTDTLS-FVLKEQQTGEVMWDA-----FSIPELQNFIRILEKEEQD 369

  Fly   777 LAREVAKIKERYAELRRRIVSRMES 801
               ::..|..||...|.::...|::
Zfish   370 ---QMCSISRRYNTYREKLEEAMKT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 25/86 (29%)
Nore1-SARAH 762..799 CDD:293125 11/39 (28%)
rassf3XP_005164556.1 GAGA_bind <1..>84 CDD:283799
C1 114..158 CDD:237996 1/4 (25%)
UBQ 259..344 CDD:294102 25/85 (29%)
Nore1-SARAH 350..389 CDD:293125 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593632
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.