DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and csrp1b

DIOPT Version :10

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001074083.1 Gene:csrp1b / 791132 ZFINID:ZDB-GENE-070112-252 Length:192 Species:Danio rerio


Alignment Length:97 Identity:32/97 - (32%)
Similarity:46/97 - (47%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
            ||..|.|.|||||..|..|..:|..|..|..|.|.|:....|.|:...||. .|||..:||:.:|
Zfish     8 KCGCCKKTVYFAEEVQCEGQSFHKSCFLCMVCRKNLDSTTVAVHQDEIYCK-SCYGKKYGPKGYG 71

  Fly    68 HG-----TRVESHKSYGVKGAQKPTGAQANGP 94
            .|     ..::..::.|::.|.:.:....|.|
Zfish    72 FGGGAGTLSMDGGEALGIRPAGETSHRPTNNP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 20/52 (38%)
RA_RASSF2_like 660..746 CDD:340482
SARAH_RASSF2-like 757..801 CDD:439180
csrp1bNP_001074083.1 LIM 7..62 CDD:413332 22/54 (41%)
LIM2_CRP 118..171 CDD:188787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.