DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf6

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_006535304.1 Gene:Rassf6 / 73246 MGIID:1920496 Length:370 Species:Mus musculus


Alignment Length:229 Identity:78/229 - (34%)
Similarity:121/229 - (52%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 EDLYTASEGVDGPDGDGSAGLHVTED-----------------GVVLRRPPRTGASAIKRRSG-- 640
            :|||..|| :|......|...|..||                 ..:|.|.....|...||...  
Mouse   134 DDLYRISE-LDRTHVLASEARHSPEDYLSYHSTLTPYADEEPESPLLYRTMSEAALVRKRMRAPE 197

  Fly   641 -NRRSRTKL--KRRCSINGHYYNRETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPG 702
             .|:.|..:  ..|.|||||.|:.|||.|||.:||:..|..:|::.|.|||..:|:|:|:::||.
Mouse   198 MYRKDRMGVLSNHRASINGHVYDHETSIFTPTFGSETKVRANSIMRTEEVIKQLLQKFKIENSPR 262

  Fly   703 NFSLFIVRDNGEQKRLKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR 767
            :|:|:|:...|||::||..:.||:.|:..||.:..|||||:| :..:|||.:||.::|.......
Mouse   263 DFALYIIFGTGEQRKLKKTDVPLLQRLLQGPSKSNARIFLMD-KDAEEISRDVAPYINFHFSFLE 326

  Fly   768 AILERYDQELAREVAKIKERYAELRRRIVSRMES 801
            :||:|.|:|...|:.:|..::...|..|:..::|
Mouse   327 SILQRLDEEEKMEIERIMAKFNTERAFILKCLQS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 37/83 (45%)
Nore1-SARAH 762..799 CDD:293125 9/36 (25%)
Rassf6XP_006535304.1 Ubiquitin_like_fold 220..306 CDD:391949 38/86 (44%)
Nore1-SARAH 320..358 CDD:374597 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848224
Domainoid 1 1.000 77 1.000 Domainoid score I8817
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4168
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043350at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.