DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Crip1

DIOPT Version :10

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001128405.1 Gene:Crip1 / 691657 RGDID:1597237 Length:77 Species:Rattus norvegicus


Alignment Length:75 Identity:46/75 - (61%)
Similarity:53/75 - (70%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWKCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQL 65
            |.||.||.|.||||||..|:|.|||..||:||:|||.|..|.||||:..|||:.|||.|:|||:.
  Rat     1 MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKG 65

  Fly    66 FGHGTRVESH 75
            ||.| ..|||
  Rat    66 FGRG-GAESH 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 32/52 (62%)
RA_RASSF2_like 660..746 CDD:340482
SARAH_RASSF2-like 757..801 CDD:439180
Crip1NP_001128405.1 LIM_CRIP 4..57 CDD:188862 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.