DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Crip2

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_077185.1 Gene:Crip2 / 68337 MGIID:1915587 Length:208 Species:Mus musculus


Alignment Length:94 Identity:46/94 - (48%)
Similarity:53/94 - (56%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
            ||.||.|.|||||:..|:|.|||..||:||.|.|.|.||.||||...|:||.|||..||||:   
Mouse     4 KCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPK--- 65

  Fly    68 HGTRVESHKSYGVKGAQKP--TGAQANGP 94
             |..:....||..   :||  ...|..||
Mouse    66 -GVNIGGAGSYIY---EKPQTEAPQVTGP 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 31/52 (60%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
Crip2NP_077185.1 LIM1_TLP 5..58 CDD:188860 31/52 (60%)
LIM1_TLP 126..179 CDD:188860
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8070
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.