DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and crip3

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001015811.1 Gene:crip3 / 548528 XenbaseID:XB-GENE-5943480 Length:203 Species:Xenopus tropicalis


Alignment Length:61 Identity:38/61 - (62%)
Similarity:45/61 - (73%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQ 64
            |..|||||:|||:..|:|.:||..||||:.|.|.|..|.||||..:|||||||||.||||:
 Frog   123 CPGCGKPVFFAEKVMSLGRNWHRPCLRCQRCNKTLTAGGHAEHDGLPYCHVPCYGYLFGPK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 31/52 (60%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
crip3NP_001015811.1 LIM1_TLP 5..58 CDD:188860
LIM2_TLP 123..176 CDD:188861 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7794
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.