DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf5

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_062238.1 Gene:Rassf5 / 54355 RGDID:621694 Length:413 Species:Rattus norvegicus


Alignment Length:393 Identity:89/393 - (22%)
Similarity:153/393 - (38%) Gaps:108/393 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 NCEHALRSIDPTLINDTMNLRSSVGSPHSAQRQYALQKSGSATVTSRDQKKPYQQ---GRQLFEK 510
            :|.|| |.:.|.|   ...||...||..                 .||.:..::|   .|.|.|:
  Rat    71 DCRHA-RPVRPGL---QQRLRRRPGSHR-----------------PRDVRSIFEQPQDPRVLAER 114

  Fly   511 GINRS------KSGPS----CFVYSDSDDDDEATLRPQRMATIRRSDIPQRYIQIQMDCYPKENV 565
            |....      :.||.    |        ..|...:..|.|..:.:..|:....||:||..||..
  Rat   115 GEGHRFAELALRGGPGWCDLC--------GREVLRQALRCANCKFTCHPECRSLIQLDCRQKEGP 171

  Fly   566 AAASEGESSRADAPSITSGAAAG----------DELTQTEDLYTASEGVDGPDGDGSAGLHVTED 620
            |...:...|.. .|:........          .|:.|..|.|.:.|       ....|:.::||
  Rat   172 ALDRQSPESTL-TPTFNKNVCKAVEETQHPPTIQEIKQKIDSYNSRE-------KHCLGMKLSED 228

  Fly   621 G---------VVLRRP--------PRTGASAIKRRSGNRRSRTKLKRRCSINGHYYNRETSFFTP 668
            |         :.||||        |::...|||  ..|..:.|             ::.|||:. 
  Rat   229 GTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIK--EVNPAATT-------------DKRTSFYL- 277

  Fly   669 PYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLF-IVRDNGEQ--KRLKDDEYPLITRVT 730
            |..:...:.:||..|.:|||..:|:|:.|..:|..|:|| .:..:|:.  ::|...:.||..|:.
  Rat   278 PLDAIKQLHISSSTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADCPLYLRLL 342

  Fly   731 LGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR---AILERYDQELAREVAKIKERYAELR 792
            .||..||.. |::...:|.::..:.     .|:||.:   .|||:.:|:   ::.:::::|.:.|
  Rat   343 AGPDTDVLS-FVLKENETGDVEWDA-----FSIPELQNFLTILEKEEQD---KIHQLQKKYNKFR 398

  Fly   793 RRI 795
            :::
  Rat   399 QKL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 27/86 (31%)
Nore1-SARAH 762..799 CDD:293125 9/37 (24%)
Rassf5NP_062238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 12/54 (22%)
C1 118..166 CDD:294036 10/55 (18%)
RASSF1_RA 267..360 CDD:176373 28/107 (26%)
Nore1-SARAH 366..405 CDD:293125 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.