DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf5

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_061220.2 Gene:Rassf5 / 54354 MGIID:1926375 Length:413 Species:Mus musculus


Alignment Length:402 Identity:91/402 - (22%)
Similarity:155/402 - (38%) Gaps:126/402 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 NCEHALRSIDPTLINDTMNLRSSVGSPHSAQRQYALQKSGSATVTSRDQKKPYQQ---GRQLFEK 510
            :|.|| |.:.|.| ...:.||.....|                   ||.:..::|   .|.|.|:
Mouse    71 DCRHA-RPVRPGL-QPRLRLRPGSHRP-------------------RDVRSIFEQPQDPRVLAER 114

  Fly   511 GINRS------KSGPS----CFVYSDSDDDDEATLRPQRMATIRRSDIPQRYIQIQMDCYPK--- 562
            |....      :.||.    |        ..|...:..|.|..:.:...:....||:||..|   
Mouse   115 GEGHRFVELALRGGPGWCDLC--------GREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGP 171

  Fly   563 ----------------ENVAAASEGESSRADAPSITSGAAAGDELTQTEDLYTASEGVDGPDGDG 611
                            :||..|.|   .....|:|       .|:.|..|.|.:.|       ..
Mouse   172 ALDRRSPESTLTPTLNQNVCKAVE---ETQHPPTI-------QEIKQKIDSYNSRE-------KH 219

  Fly   612 SAGLHVTEDG---------VVLRRP--------PRTGASAIKRRSGNRRSRTKLKRRCSINGHYY 659
            ..|:.::|||         :.||||        |::...|||  ..|..:.|             
Mouse   220 CLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIK--EVNPAATT------------- 269

  Fly   660 NRETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLF-IVRDNGEQ--KRLKDD 721
            ::.|||:. |..:...:.:||..|.:|||..:|:|:.|..:|..|:|| .:..:|:.  ::|...
Mouse   270 DKRTSFYL-PLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIA 333

  Fly   722 EYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR---AILERYDQELAREVAK 783
            :|||..|:..||..||.. |::...:|.|:..:.     .|:||.:   .|||:.:|:   ::.:
Mouse   334 DYPLYLRLLAGPDTDVLS-FVLKENETGEVEWDA-----FSIPELQNFLTILEKEEQD---KIHQ 389

  Fly   784 IKERYAELRRRI 795
            ::::|.:.|:::
Mouse   390 LQKKYNKFRQKL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 28/86 (33%)
Nore1-SARAH 762..799 CDD:293125 9/37 (24%)
Rassf5NP_061220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 11/52 (21%)
C1_1 118..166 CDD:278556 9/55 (16%)
UBQ 267..360 CDD:294102 29/107 (27%)
Nore1-SARAH 366..405 CDD:293125 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.