DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and csrp3

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001307020.1 Gene:csrp3 / 450005 ZFINID:ZDB-GENE-041010-119 Length:222 Species:Danio rerio


Alignment Length:96 Identity:33/96 - (34%)
Similarity:42/96 - (43%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
            ||..|.|.||.||..|.....:|..|..|..|.|.|:....|.|:|..||.. |||..:||:.:|
Zfish    38 KCAACEKTVYHAEEIQCNSRSFHKTCFICMVCRKGLDSTTVAAHESEIYCKT-CYGKKYGPKGYG 101

  Fly    68 HGTRVESHKSYGVKGAQKPTGAQANGPPLPR 98
            :|....:..|..|...:    .|...|..||
Zfish   102 YGQGAGALSSDPVNNEE----LQPQEPKAPR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 19/52 (37%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
csrp3NP_001307020.1 LIM1_CRP3 38..91 CDD:188865 20/53 (38%)
LIM2_CRP3 149..202 CDD:188866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.