powered by:
Protein Alignment Rassf and csrp1
DIOPT Version :9
Sequence 1: | NP_651126.3 |
Gene: | Rassf / 42734 |
FlyBaseID: | FBgn0039055 |
Length: | 806 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006881.1 |
Gene: | csrp1 / 448688 |
XenbaseID: | XB-GENE-941448 |
Length: | 193 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 27/66 - (40%) |
Similarity: | 33/66 - (50%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 CHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFGH 68
|.:|.|.||.||:....|..||..|.||.:|||.|.....|:.....:|.. ||...|||:.||.
Frog 119 CPRCSKSVYAAEKVIGAGNSWHRTCFRCSKCGKGLESTTVADRDGDIFCKA-CYAKNFGPKGFGF 182
Fly 69 G 69
|
Frog 183 G 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000284 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.