DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and rassf1

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001004550.1 Gene:rassf1 / 447811 ZFINID:ZDB-GENE-040912-14 Length:363 Species:Danio rerio


Alignment Length:282 Identity:72/282 - (25%)
Similarity:118/282 - (41%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 IQMDC------------YPKE------NVAAASEGESSRADAPSITSGAAAGDELTQTEDLYTAS 601
            ||:||            |.::      ||...||.:..:.|. |:|       |:.|....|.|.
Zfish   111 IQLDCSSNTDTICEQSNYSEDTIETDTNVDEQSEVDWRKQDL-SVT-------EIQQKVKEYNAQ 167

  Fly   602 EG-----VDGPDGDGSAGLHVTEDGVVLRR-----PPRTGASAIKRRSGNRRSRTKLKRRC-SIN 655
            ..     |...||..:..:.|.   ..|.|     |||:.:|            :.:...| ..:
Zfish   168 VNSNLFMVLNRDGSYTGFIKVQ---FKLARPVSLPPPRSVSS------------SSISSSCLGWD 217

  Fly   656 GHYYNRETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLF--IVRDNGEQ-KR 717
            |....| |||:. |..:...:.:||.....|||..:|.|:.|..:|..:||:  ..|||... ::
Zfish   218 GGCQER-TSFYL-PRDTVKHLHISSSTRAREVIQALLNKFTVVDNPAKYSLYERSQRDNQVYLRK 280

  Fly   718 LKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR---AILERYDQELAR 779
            |.|||.||..|:..||:|.|..:.|.:: :|.|::.:.     .|.||.:   .||:|.:::..|
Zfish   281 LADDECPLFLRLCAGPNEKVLSLVLKEN-ETGEVNWDA-----FSFPELQNFLRILQREEEDHVR 339

  Fly   780 EVAKIKERYAELRRRIVSRMES 801
            ::.:   ||...|.::...|::
Zfish   340 QIIR---RYTLARDKMKEAMKN 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 31/86 (36%)
Nore1-SARAH 762..799 CDD:293125 10/39 (26%)
rassf1NP_001004550.1 C1 66..115 CDD:197519 2/3 (67%)
UBQ 218..311 CDD:294102 32/95 (34%)
Nore1-SARAH 317..356 CDD:293125 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.