powered by:
Protein Alignment Rassf and csrp2
DIOPT Version :9
Sequence 1: | NP_651126.3 |
Gene: | Rassf / 42734 |
FlyBaseID: | FBgn0039055 |
Length: | 806 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_957191.1 |
Gene: | csrp2 / 393871 |
ZFINID: | ZDB-GENE-040426-1863 |
Length: | 193 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 29/67 - (43%) |
Similarity: | 34/67 - (50%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
||.:||..||.||:..|.|..||..|.||.:|||.|......|.....||.. ||...|||:..|
Zfish 118 KCARCGDAVYAAEKIMSAGKPWHKNCFRCAKCGKSLESTTQTEKDGEIYCKA-CYAKNFGPKGCG 181
Fly 68 HG 69
:|
Zfish 182 YG 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000284 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.