DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Mlp60A

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001137750.1 Gene:Mlp60A / 37853 FlyBaseID:FBgn0259209 Length:486 Species:Drosophila melanogaster


Alignment Length:106 Identity:35/106 - (33%)
Similarity:46/106 - (43%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
            ||..|||.||.||.:.:.||.:|..|.:|..|.|.|:.....||:...:|. .|:|..:||:.:|
  Fly    10 KCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEKELFCK-NCHGRKYGPKGYG 73

  Fly    68 HGTRVESHKSYGVKGAQKPTGAQANG-------PPLPRDHL 101
            .|.        |.......|||..|.       ||...|.|
  Fly    74 FGG--------GAGCLSTDTGAHLNREFVPPKIPPKAPDGL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 19/52 (37%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
Mlp60ANP_001137750.1 LIM1_MLP84B_like 10..63 CDD:188788 20/53 (38%)
LIM_CRP_like 108..161 CDD:188712
LIM_CRP_like 213..266 CDD:188712
LIM 316..369 CDD:413332
LIM_CRP_like 412..465 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.