DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf1

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001032644.1 Gene:Rassf1 / 363140 RGDID:1359383 Length:340 Species:Rattus norvegicus


Alignment Length:391 Identity:87/391 - (22%)
Similarity:149/391 - (38%) Gaps:113/391 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 SIDPTLINDTMNLRSSVGSPHSAQRQYALQKSGSATVTSRDQKKPYQQ---GRQLFEKGINRSKS 517
            |.:|.||    .||....|......:..|:::.:..:.....:.|.||   ||     |.....:
  Rat     2 SAEPELI----ELRELAPSGRIGPGRTRLERANALRIAPGTTRNPSQQHVPGR-----GHRFQPA 57

  Fly   518 GPSCFVYSDSDDDDEATLRPQRMATIRRSDIPQRYIQ----------IQMDCY-PKE-------- 563
            ||:...:.|...|        .:..:.|..:...:.:          :.:||. |::        
  Rat    58 GPTTHTWCDLCGD--------FIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWDPALE 114

  Fly   564 ---NVAAASEGESSRADAPSITSGAAAGDELTQTEDLYTASEGVDGPDGDGSAGLHVT--EDG-- 621
               ||..|.|.|:               .:|:|.|    ..:.:...:|..::.|.::  :||  
  Rat   115 RDTNVDEAVERET---------------PDLSQAE----TEQKIKDYNGQINSNLFMSLNKDGSY 160

  Fly   622 -----VVL-----------RRPPRTGASAIKRRSGNRRSRTKLKRRCSINGHYYNRETSFFTPPY 670
                 |.|           ::||    |....|.|..|| :.:|||           |||:.|. 
  Rat   161 TGFIKVQLKLVRPVSVPSSKKPP----SLQDARRGTGRS-SAVKRR-----------TSFYLPK- 208

  Fly   671 GSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQ---KRLKDDEYPLITRVTLG 732
            .:...:.|.|.....|||..:|.|:.|...|..|:||...:...|   ::|.|:|.||..|:..|
  Rat   209 DAVKHLHVLSRTRAREVIEALLRKFMVVDDPRKFALFERTERHGQIYFRKLSDEEQPLKLRLLAG 273

  Fly   733 PHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECR---AILERYDQELAREVAKIKERYAELRRR 794
            |.|. |..|::....:.|::.:.     .|:||..   .||:|.::|..|:   |.::|:..|::
  Rat   274 PSEK-ALSFVLKENDSGEVNWDA-----FSMPELHNFLRILQREEEEHLRQ---ILQKYSRCRQK 329

  Fly   795 I 795
            |
  Rat   330 I 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 28/86 (33%)
Nore1-SARAH 762..799 CDD:293125 12/37 (32%)
Rassf1NP_001032644.1 C1_RASSF1 49..102 CDD:410435 9/65 (14%)
RA_RASSF1 130..286 CDD:340738 47/177 (27%)
Nore1-SARAH 296..334 CDD:406824 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.