DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf3

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001102217.2 Gene:Rassf3 / 362886 RGDID:1311450 Length:233 Species:Rattus norvegicus


Alignment Length:234 Identity:56/234 - (23%)
Similarity:91/234 - (38%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 SEGVDGPDGDGSAGLHVTEDGVVLRRPP---RTGASAIKRRSG-----------------NRRSR 645
            |.|....:.|..............|.||   |:|...:::...                 |....
  Rat     2 SSGYSSLEEDAEDFFFTARTSFFRRAPPGKSRSGQPDVEKEKETHNYLSKEEIKEKVHKYNLAVT 66

  Fly   646 TKLKRRCSINGHYYNRETSFF-----------TP----PYGSQMSVWVSSMVTTTEVINLVLEKY 695
            .|||...:.||.|    |.|.           ||    ..|...::.:||..|..:||:.:|:|:
  Rat    67 DKLKMTLNSNGIY----TGFIKVQMELCKPAQTPANPSSSGCMNTLHISSTNTVGDVIDALLKKF 127

  Fly   696 KVDSSPGNFSLFIVRDNGEQK----RLKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVA 756
            :|..||..|:|: .|.:.|.:    :|.|.|:||..|:..||..|.....|.:        :|:.
  Rat   128 QVTESPTKFALY-KRCHREDQVYACKLSDREHPLYLRLVAGPRTDTLSFVLRE--------HEIG 183

  Fly   757 QFLNLSLPECRAILERYDQELAREVAKIKERYAELRRRI 795
            ::...||||.:..|...|:|...::..:|.||...|:::
  Rat   184 EWEAFSLPELQNFLRILDKEEDEQLQSLKRRYTAYRQKL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 29/102 (28%)
Nore1-SARAH 762..799 CDD:293125 11/34 (32%)
Rassf3NP_001102217.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.