DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf4

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001019446.1 Gene:Rassf4 / 362423 RGDID:1307785 Length:322 Species:Rattus norvegicus


Alignment Length:390 Identity:107/390 - (27%)
Similarity:173/390 - (44%) Gaps:95/390 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 PIDPSRIHDSLKLYGENSAMSKSFNCEHALRSID--------PTLINDTMNLRSSVGSPHSAQRQ 481
            ||..|:    ..|..|..::.|::||.|..||..        ..:|...:|:...:..|...|.|
  Rat    12 PISDSK----FILKSELLSLLKTYNCYHEGRSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQ 72

  Fly   482 YALQKSGSATVTSRDQKKPYQQGRQLFEKGINRSKSGPSCFVYSDSDDDDEATLRPQRMATIRRS 546
                                                           ||.|....|.  ||.   
  Rat    73 -----------------------------------------------DDRERVHLPS--ATW--- 85

  Fly   547 DIPQRYIQIQMDCYPKENVAAASEGESSRADAPSITSGAAAGDELTQTEDLYTASEGVDGPDGDG 611
             :|:|...:|.|..|:::...|.|..:..|:...::.                          ||
  Rat    86 -VPERLSYLQKDASPQDSKVPAEEPSTQPANKGEVSR--------------------------DG 123

  Fly   612 SAGLHVTEDGV-VLRRPPRTGASAIKRRSGNRR--SRTKLKR-RCSINGHYYNRETSFFTPPYGS 672
            |..|...|:.| .|.|.....:..|:||..:|.  ...|::| |.|||||:||.:||.|||.|||
  Rat   124 SGPLQEEEEEVPQLMRTKSDASCIIQRRCKSRAPGEAQKIRRHRFSINGHFYNHKTSVFTPAYGS 188

  Fly   673 QMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKDDEYPLITRVTLGPHEDV 737
            ..:|.|:|.:||.:|:.|:|.|::|:..|..|:|:.|.::|||.:|||.|||||:|:..||.|.:
  Rat   189 VTNVRVNSTMTTQQVLTLLLNKFRVEDGPSEFALYTVHESGEQTKLKDCEYPLISRILHGPCEKI 253

  Fly   738 ARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAKIKERYAELRRRIVSRMESL 802
            .:|||:::..::|:.::|||::...:|...:.:|:..:|..||:.|:..::..||..:..|:|.|
  Rat   254 VKIFLMEADLSEEVPHDVAQYIKFEMPVLDSFVEKLKEEEEREIIKLTMKFQALRLTMQQRLEQL 318

  Fly   803  802
              Rat   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 41/83 (49%)
Nore1-SARAH 762..799 CDD:293125 8/36 (22%)
Rassf4NP_001019446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..140 12/69 (17%)
UBQ 176..262 CDD:294102 41/85 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351800
Domainoid 1 1.000 77 1.000 Domainoid score I8636
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12926
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043350at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46000
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22738
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2208
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.810

Return to query results.
Submit another query.