DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and CG33521

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001014703.1 Gene:CG33521 / 3346141 FlyBaseID:FBgn0250819 Length:663 Species:Drosophila melanogaster


Alignment Length:643 Identity:135/643 - (20%)
Similarity:222/643 - (34%) Gaps:173/643 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CHKCGKPVYFAER----KQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQ 64
            ||:|.||||..|.    .::....:|..||||::|||.|....:..|....||.:. :..:|.|:
  Fly    80 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMH-FKLIFAPK 143

  Fly    65 LFGHGTRVESHKSYGVKGAQ-----------KPTGAQANGPP------LPRDHLESKLKVYNQFY 112
            :.        ::.:..:.|:           .|..|:|:..|      |...:|.||.||:...|
  Fly   144 VV--------YEEFTPRKAELIIRENQPIKLPPDVAKASDKPSLGLDELQELNLRSKFKVFENGY 200

  Fly   113 DNKSLEIRSRE---VNNRLVLEGALRVYWGVQGVIH---LKEDD-----------DQRILVRKRN 160
            :..:..:|.|:   :.:...::..|..:.|: |:.:   .|.||           |...:..|:.
  Fly   201 EEHNNNLRERQDIAITHSKSIQSTLTKFHGL-GIPNSELTKLDDKNSDNNSDGDGDMNFMCLKKE 264

  Fly   161 SCR-----VSKAANESSSD--------KENEASESLAPPTTTTAEVDQLSTDVSLSESMTFDSC- 211
            ..|     :.:|.|:..|.        ||....|       ...|:..:.:.:.|.:....... 
  Fly   265 IERETPVGLGEAMNDIRSKFEQGDLMAKEGRREE-------RKQEIQNIRSRLFLGKQAKIKEMY 322

  Fly   212 ------SLNEISELPTTPEDASANTTANSKEQ-TNGNVCNDDEDTTTTDSSGTLVEAPT--ASTS 267
                  |...::.:..||:..:...|...|.: .||.|..|.:..::..|.|...:|..  :..|
  Fly   323 KLAVAESEQPVTSVGKTPDICAIKPTQEIKNRFENGEVYKDSKILSSEVSCGIHEDADVFESGIS 387

  Fly   268 CVSSTLPSKLDRLEK------LDWDDIDDLLQVERRHNDKDRIYETMPVKLPSSQSSSDSSPSKT 326
            ..|..:..|||...|      :.:...|...|:   ||.|  :.|...|::    ..|||.|.  
  Fly   388 KASRNIFMKLDANIKSGLSNHVQYTLPDKKYQI---HNQK--VQENSDVEI----VKSDSKPE-- 441

  Fly   327 STETTTTTESSSTQSASTNTSSTDDFMTATGSLT-------------ANTNTQNTTTV------- 371
              |....||..|.:.....|.|..:.......:|             :.||.|.:||:       
  Fly   442 --EVKVATEELSKKFKFFETYSPAENKKRIFRMTPPREGVVMFPPPDSETNQQISTTLFNDNILQ 504

  Fly   372 --STTETSLDNFETCDDATLKPIDFEDFKRSVHQDYVN--GANSFTEPNEGTLKRNQPIDPSRIH 432
              .||.|.|:.|.          :.|:.|.|..|...|  ....||.|.|.:   :|.|......
  Fly   505 KTKTTSTILNKFR----------EMEEQKMSDQQKKKNPKPLKCFTPPPEIS---HQFIRSDTEE 556

  Fly   433 DSLKLYGENSAMSKSFNCEHALRSIDPTLINDTMNLRSSVGSPHSAQRQYALQKSGSATVTSRDQ 497
            :|...|.:||.                   ||.   .|.:...:|.....||.::.|....    
  Fly   557 ESDSDYEQNSE-------------------NDE---ESEINPSNSYYNDKALLEAQSVARA---- 595

  Fly   498 KKPYQQGRQLFEKGINRS-----KSGPSCFVYS---DSDDDDEATLRPQRMATIRRSD 547
                :|.|..|||..|..     |.| ...|||   .::..:.|....:|...:::|:
  Fly   596 ----KQLRAKFEKWQNNEIEQEIKEG-RIDVYSQLISNESIESAKAIRERFENMKKSE 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 20/56 (36%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
CG33521NP_001014703.1 LIM_Mical_like_2 80..136 CDD:188829 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.