DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Mical2

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001180234.1 Gene:Mical2 / 320878 MGIID:2444947 Length:1102 Species:Mus musculus


Alignment Length:41 Identity:16/41 - (39%)
Similarity:21/41 - (51%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHA 44
            |:.|.|.||..||..:.|:.:|.||.||..|...|....:|
Mouse   980 CYFCKKRVYMIERLSAEGHFFHQECFRCSVCSATLRLAAYA 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 16/41 (39%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
Mical2NP_001180234.1 Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 2..494
UbiH 87..>224 CDD:357568
CH 522..623 CDD:366016
Nuclear localization signal. /evidence=ECO:0000250 660..681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 662..712
LIM_Mical 980..1034 CDD:188823 16/41 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.