DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Mical1

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_038954550.1 Gene:Mical1 / 294520 RGDID:1309386 Length:1058 Species:Rattus norvegicus


Alignment Length:368 Identity:69/368 - (18%)
Similarity:112/368 - (30%) Gaps:131/368 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVP-----YC--HVPCYGALF 61
            |..|||.:|..||....|:.:|..|..|..|...|.||.:.::   |     ||  |:|      
  Rat   681 CELCGKRLYILERFCVDGHFFHRGCFCCRTCEATLRPGGYGQY---PGDGYFYCLQHLP------ 736

  Fly    62 GPQLFGHGTRVESHKSYGVKGAQKPTGAQA---NGP-----------PLPRD--------HLES- 103
                  ...:.|:..:...:..:.||...:   :||           |:|..        .|.| 
  Rat   737 ------QEDQKEADNNGSPENQELPTPGDSTTQSGPSSPVPPVTEASPVPSPSQPARRLIRLSSV 795

  Fly   104 ---KLKVYNQFYDN----------KSLEIRSREVNNRLVLEGALRVYWGVQGVIHLKEDDDQRIL 155
               :|...|...|:          ..|::....:.:..       :.|||.....:.|       
  Rat   796 ERLRLSSLNIIPDSGVEPPPKPPRSCLDLAQESLKSSF-------MGWGVLRAPQVPE------- 846

  Fly   156 VRKRNSCRVSKAANESSSDKENEASESLAPPTTTTAEVDQLSTDVSLSESMTFDSCSLNEISELP 220
                   .:.|...|...::|.|..|...||        .|:.:|.....:|           .|
  Rat   847 -------AIEKGEEEEEEEEEEEEEEEELPP--------PLALEVEQGPDLT-----------AP 885

  Fly   221 TTPEDASANTTANSKEQTNGNVCNDDEDTTTTDSSGTLVEAPTASTSCVSSTLPSKLDRLEKLDW 285
            |.|:..                      .|...:||.:.:.||...:.:......::.|..|.. 
  Rat   886 TLPQSL----------------------LTLAKNSGDMTKYPTWRRTLMRRAKEEEMKRFCKAQ- 927

  Fly   286 DDIDDLLQVERRHNDKD---RIYETMPVKLPSSQSSSDSSPSK 325
                   .::||.|:.:   |..||..:||..:.....|||.|
  Rat   928 -------AIQRRLNEIEAAMRELETEGMKLEVALRKESSSPEK 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 20/59 (34%)
UBQ 660..744 CDD:294102
Nore1-SARAH 762..799 CDD:293125
Mical1XP_038954550.1 FAD_binding_3 85..>122 CDD:396193
CH_MICAL1 506..611 CDD:409045
LIM 681..734 CDD:413332 18/55 (33%)
DUF3585 929..1056 CDD:403377 12/35 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.