DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and RASSF3

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_835463.1 Gene:RASSF3 / 283349 HGNCID:14271 Length:238 Species:Homo sapiens


Alignment Length:239 Identity:57/239 - (23%)
Similarity:89/239 - (37%) Gaps:57/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 SEGVDGPDGDGSAGLHVTEDGVVLRRP---PRTGASAIKRRSG-----------------NRRSR 645
            |.|....:.|..............|.|   ||:|...:::...                 |....
Human     2 SSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVT 66

  Fly   646 TKLKRRCSINGHYYNRETSFF-------TPPY-------------GSQMSVWVSSMVTTTEVINL 690
            .|||...:.||.|    |.|.       .||.             |...::.:||..|..|||..
Human    67 DKLKMTLNSNGIY----TGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNTLHISSTNTVGEVIEA 127

  Fly   691 VLEKYKVDSSPGNFSLFIVRDNGEQK----RLKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEI 751
            :|:|:.|..||..|:|: .|.:.|.:    :|.|.|:||..|:..||..|.....|.:       
Human   128 LLKKFLVTESPAKFALY-KRCHREDQVYACKLSDREHPLYLRLVAGPRTDTLSFVLRE------- 184

  Fly   752 SNEVAQFLNLSLPECRAILERYDQELAREVAKIKERYAELRRRI 795
             :|:.::...||||.:..|...|:|...::..:|.||...|:::
Human   185 -HEIGEWEAFSLPELQNFLRILDKEEDEQLQNLKRRYTAYRQKL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 30/107 (28%)
Nore1-SARAH 762..799 CDD:293125 11/34 (32%)
RASSF3NP_835463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..48 5/21 (24%)
UBQ 79..188 CDD:320785 32/121 (26%)
Nore1-SARAH 192..231 CDD:318672 11/36 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.