DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and Rassf2

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001349795.1 Gene:Rassf2 / 215653 MGIID:2442060 Length:326 Species:Mus musculus


Alignment Length:272 Identity:87/272 - (31%)
Similarity:147/272 - (54%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 QRYIQIQMDCYPKENVAAASEGESSRADAPSITSGAAAGDEL--------------TQTEDLYTA 600
            :|.|::||            :.:..|...|..:|...:|..|              .|..::...
Mouse    63 RRPIRLQM------------QDDHERIRPPPSSSSWHSGCNLGAQGTTLKPLTMPTVQISEVDMP 115

  Fly   601 SEGVDGPDGDGSAGLH-VTEDGVVLRRPPRTGASAIKRRSGNRRSRTKLKR----RCSINGHYYN 660
            .||::......|.||. |.||...|.   ||.:....||.||.|:.:..:|    |.|||||:||
Mouse   116 VEGLETHSPTDSRGLKPVQEDTPQLM---RTRSDVGVRRRGNVRTSSDQRRIRRHRFSINGHFYN 177

  Fly   661 RETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKDDEYPL 725
            .:||.|||.|||..:|.::|.:||.:|:.|:|.|:|:::|...|:|::|..:||::|||..:|||
Mouse   178 HKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQRLKSSDYPL 242

  Fly   726 ITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAKIKERYAE 790
            |.|:..||.|.::::||::..:.:|::.:|||::...:|..::.:::..:|..|||.|:..:|..
Mouse   243 IARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVEKLMRKYTV 307

  Fly   791 LRRRIVSRMESL 802
            ||..|..|:|.:
Mouse   308 LRLMIRQRLEEI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 37/83 (45%)
Nore1-SARAH 762..799 CDD:293125 10/36 (28%)
Rassf2NP_001349795.1 RA_RASSF2 177..263 CDD:340741 37/85 (44%)
Nore1-SARAH 277..316 CDD:374597 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848222
Domainoid 1 1.000 77 1.000 Domainoid score I8817
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4168
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43912
orthoMCL 1 0.900 - - OOG6_105083
Panther 1 1.100 - - LDO PTHR22738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5365
SonicParanoid 1 1.000 - - X2208
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.